RegulonDB RegulonDB 10.8: Gene Form
   

nlpI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pnp nlpI yrbN deaD TSS_3450 TSS_3450 TSS_3449 TSS_3449 TSS_3448 TSS_3448 TSS_3447 (cluster) TSS_3447 (cluster) TSS_3446 (cluster) TSS_3446 (cluster) TSS_3445 TSS_3445 TSS_3444 TSS_3444 TSS_3443 TSS_3443 TSS_3442 TSS_3442 TSS_3441 TSS_3441 TSS_3440 TSS_3440 TSS_3439 TSS_3439 nlpIp2 nlpIp2 TSS_3438 TSS_3438 TSS_3437 TSS_3437 TSS_3436 TSS_3436 yrbNp yrbNp TSS_3435 TSS_3435 deaDp1 deaDp1

Gene      
Name: nlpI    Texpresso search in the literature
Synonym(s): ECK3151, EG12371, b3163, yhbM
Genome position(nucleotides): 3308040 <-- 3308924 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.25
External database links:  
ASAP:
ABE-0010395
ECHOBASE:
EB2274
OU-MICROARRAY:
b3163
PortEco:
nlpI
STRING:
511145.b3163
COLOMBOS: nlpI


Product      
Name: lipoprotein NlpI
Synonym(s): NlpI, YhbM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,outer membrane
Molecular weight: 33.621
Isoelectric point: 4.342
Motif(s):
 
Type Positions Sequence
19 -> 294 CSNTSWRKSEVLAVPLQPTLQQEVILARMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEQWGWNIVEFYLGNISEQTLMERLKADATDNTSLAEHLSETNFYLGKYYLSLGDLDSATALFKLAVANNVHNFVEHRYALLELSLLGQDQDDLAESDQQ
58 -> 91 DDERAQLLYERGVLYDSLGLRALARNDFSQALAI
62 -> 95 AQLLYERGVLYDSLGLRALARNDFSQALAIRPDM
130 -> 163 NYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPND
131 -> 159 YAHLNRGIALYYGGRDKLAQDDLLAFYQD

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0036405 - anchored component of cell outer membrane
molecular_function GO:0005515 - protein binding
GO:0030674 - protein-macromolecule adaptor activity
GO:0042803 - protein homodimerization activity
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0051301 - cell division
GO:0007049 - cell cycle
External database links:  
DIP:
DIP-48051N
ECOCYC:
EG12371-MONOMER
ECOLIWIKI:
b3163
INTERPRO:
IPR019734
INTERPRO:
IPR023605
INTERPRO:
IPR013105
INTERPRO:
IPR013026
INTERPRO:
IPR011990
MODBASE:
P0AFB1
PDB:
5WQL
PDB:
6IQQ
PDB:
6IQS
PDB:
6IQU
PDB:
1XNF
PFAM:
PF07719
PFAM:
PF13181
PRIDE:
P0AFB1
PRODB:
PRO_000023396
PROSITE:
PS50293
PROSITE:
PS51257
PROSITE:
PS50005
REFSEQ:
NP_417632
SMART:
SM00028
SMR:
P0AFB1
SWISSMODEL:
P0AFB1
UNIPROT:
P0AFB1


Operon      
Name: nlpI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter deaDp1 3307909 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3435 3308055 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3436 3308214 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3437 3308694 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3438 3308871 reverse nd [RS-EPT-CBR] [2]
  promoter nlpIp2 3309040 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3439 3309284 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3440 3309502 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3441 3309519 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3442 3309525 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3443 3309527 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3444 3309617 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3445 3310026 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3446 (cluster) 3310204 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3447 (cluster) 3310283 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3448 3310380 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3449 3310391 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3450 3310952 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB