RegulonDB RegulonDB 10.9: Gene Form
   

yhfG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fic ppiA pabA yhfG yhfGp yhfGp pabAp1 pabAp1

Gene      
Name: yhfG    Texpresso search in the literature
Synonym(s): ECK3350, EG12374, b3362, ficA
Genome position(nucleotides): 3491453 <-- 3491620 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.19
External database links:  
ASAP:
ABE-0010989
ECHOBASE:
EB2277
ECOLIHUB:
yhfG
OU-MICROARRAY:
b3362
STRING:
511145.b3362
COLOMBOS: yhfG


Product      
Name: DUF2559 domain-containing protein YhfG
Synonym(s): FicA, YhfG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 6.599
Isoelectric point: 10.804
Motif(s):
 
Type Positions Sequence
2 -> 55 KKLTDKQKSRLWELQRNRNFQASRRLEGVEMPLVTLTAAEALARLEELRSHYER

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48177N
ECOCYC:
EG12374-MONOMER
ECOLIWIKI:
b3362
INTERPRO:
IPR022541
PDB:
5JFF
PDB:
5JFZ
PFAM:
PF10832
PRIDE:
P0ADX5
REFSEQ:
NP_417821
SMR:
P0ADX5
UNIPROT:
P0ADX5


Operon      
Name: yhfG-fic-pabA         
Operon arrangement:
Transcription unit        Promoter
pabA
yhfG-fic-pabA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB