RegulonDB RegulonDB 10.8: Gene Form
   

dauA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: dauA    Texpresso search in the literature
Synonym(s): ECK1194, EG12392, b1206, ychM
Genome position(nucleotides): 1259124 <-- 1260803 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.64
External database links:  
ASAP:
ABE-0004051
ECHOBASE:
EB2293
OU-MICROARRAY:
b1206
PortEco:
ychM
STRING:
511145.b1206
COLOMBOS: dauA


Product      
Name: aerobic C4-dicarboxylate transporter DauA
Synonym(s): DauA, YchM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 59.429
Isoelectric point: 9.004
Motif(s):
 
Type Positions Sequence
29 -> 411 FTRDLIAGITVGIIAIPLAMALAIGSGVAPQYGLYTAAVAGIVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMGLARFGRLIEYIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPTINVGDAAIGIVTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGGHVATIGSQFHYVLADGSQGNGIPQLLPQLVLPWDLPNSEFTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVLDGMTGTKHKANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILVILALLVLAPLLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVM
33 -> 53 LIAGITVGIIAIPLAMALAIG
213 -> 233 LLAGCAVMGIVNLLGGHVATI
314 -> 334 LVGQGLGNIIAPFFGGITATA
80 -> 100 FSVSGPTAAFVVILYPVSQQF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.A - Transporters of Unknown Classification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015183 - L-aspartate transmembrane transporter activity
GO:0015116 - sulfate transmembrane transporter activity
GO:0008271 - secondary active sulfate transmembrane transporter activity
GO:0015138 - fumarate transmembrane transporter activity
GO:0015141 - succinate transmembrane transporter activity
biological_process GO:0015810 - aspartate transmembrane transport
GO:0008272 - sulfate transport
GO:0055085 - transmembrane transport
GO:0015741 - fumarate transport
GO:0070778 - L-aspartate transmembrane transport
GO:0071422 - succinate transmembrane transport
GO:1902358 - sulfate transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Riley M., et al., 2006
[2] Serres MH., et al., 2001
External database links:  
DIP:
DIP-48160N
ECOCYC:
YCHM-MONOMER
ECOLIWIKI:
b1206
INTERPRO:
IPR002645
INTERPRO:
IPR036513
INTERPRO:
IPR018045
INTERPRO:
IPR011547
INTERPRO:
IPR001902
MODBASE:
P0AFR2
PANTHER:
PTHR11814
PDB:
3NY7
PFAM:
PF00916
PFAM:
PF01740
PRIDE:
P0AFR2
PROSITE:
PS50801
PROSITE:
PS01130
REFSEQ:
NP_415724
SMR:
P0AFR2
UNIPROT:
P0AFR2


Operon      
Name: dauA         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1536 1258938 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1537 1259525 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1538 1260982 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1539 1261162 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1540 1261821 reverse nd [RS-EPT-CBR] [3]



RegulonDB