RegulonDB RegulonDB 10.9: Gene Form
   

modA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

modC modA modB acrZ ModE CRP terminator anti-anti-terminator anti-terminator modAp modAp modAp1 modAp1

Gene      
Name: modA    Texpresso search in the literature
Synonym(s): ECK0752, EG12427, b0763
Genome position(nucleotides): 795089 --> 795862 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.9
External database links:  
ASAP:
ABE-0002601
CGSC:
37372
ECHOBASE:
EB2325
ECOLIHUB:
modA
OU-MICROARRAY:
b0763
STRING:
511145.b0763
COLOMBOS: modA


Product      
Name: molybdate ABC transporter periplasmic binding protein
Synonym(s): ModA
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 27.364
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
175 -> 175 D
218 -> 218 V
1 -> 24 MARKWLNLFAGAALSFAVAGNALA
29 -> 254 ITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGF
177 -> 177 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.4 - molybdenum
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:1901359 - tungstate binding
GO:0030973 - molybdate ion binding
GO:0046872 - metal ion binding
GO:0015412 - ATPase-coupled molybdate transmembrane transporter activity
GO:0030151 - molybdenum ion binding
biological_process GO:0046687 - response to chromate
GO:0015689 - molybdate ion transport
Note(s): Note(s): ...[more].
Reference(s): [1] Aryal BP., et al., 2012
[2] Dudev T., et al., 2004
[3] Maupin-Furlow JA., et al., 1995
External database links:  
ECOCYC:
MODA-MONOMER
ECOLIWIKI:
b0763
INTERPRO:
IPR005950
MODBASE:
P37329
PDB:
1WOD
PDB:
4XXU
PDB:
3R26
PDB:
3AXF
PDB:
1AMF
PFAM:
PF13531
PRIDE:
P37329
PRODB:
PRO_000023267
REFSEQ:
NP_415284
SMR:
P37329
UNIPROT:
P37329


Operon      
Name: modABC         
Operon arrangement:
Transcription unit        Promoter
modABC
modABC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: ModE


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Aryal BP., Brugarolas P., He C., 2012, Binding of ReO4(-) with an engineered MoO4(2-)-binding protein: towards a new approach in radiopharmaceutical applications., J Biol Inorg Chem 17(1):97-106

 [2] Dudev T., Lim C., 2004, Oxyanion selectivity in sulfate and molybdate transport proteins: an ab initio/CDM study., J Am Chem Soc 126(33):10296-305

 [3] Maupin-Furlow JA., Rosentel JK., Lee JH., Deppenmeier U., Gunsalus RP., Shanmugam KT., 1995, Genetic analysis of the modABCD (molybdate transport) operon of Escherichia coli., J Bacteriol 177(17):4851-6


RegulonDB