RegulonDB RegulonDB 10.9: Gene Form
   

ydiF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydiF ydiO aroD

Gene      
Name: ydiF    Texpresso search in the literature
Synonym(s): ECK1692, EG12432, b1694
Genome position(nucleotides): 1775587 --> 1777182 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.49
External database links:  
ASAP:
ABE-0005656
ECHOBASE:
EB2328
ECOLIHUB:
ydiF
OU-MICROARRAY:
b1694
STRING:
511145.b1694
COLOMBOS: ydiF


Product      
Name: putative acetate-CoA transferase YdiF
Synonym(s): YdiF, fused predicted acetyl-CoA:acetoacetyl-CoA transferase: alpha; subunit/beta; subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 57.562
Isoelectric point: 5.525
Motif(s):
 
Type Positions Sequence
16 -> 252 LSAQEAVNYIPDEATLCVLGAGGGILEATTLITALADKYKQTQTPRNLSIISPTGLGDRADRGISPLAQEGLVKWALCGHWGQSPRISELAEQNKIIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIVMMQVQKMVKKATLHPKSVRIPGYLVDIVVV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008410 - CoA-transferase activity
GO:0008775 - acetate CoA-transferase activity
biological_process GO:0046459 - short-chain fatty acid metabolic process
GO:0046952 - ketone body catabolic process
GO:0051289 - protein homotetramerization
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12432-MONOMER
ECOLIWIKI:
b1694
INTERPRO:
IPR014388
INTERPRO:
IPR037171
INTERPRO:
IPR004165
MODBASE:
P37766
PFAM:
PF01144
PRIDE:
P37766
REFSEQ:
NP_416209
SMART:
SM00882
SMR:
P37766
SWISSMODEL:
P37766
UNIPROT:
P37766


Operon      
Name: ydiFO         
Operon arrangement:
Transcription unit        Promoter
ydiFO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB