RegulonDB RegulonDB 11.0: Gene Form
   

mdtM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjiN mdtM ytiE

Gene      
Name: mdtM    Texpresso search in the literature
Synonym(s): ECK4328, EG12576, b4337, yjiO
Genome position(nucleotides): 4567287 <-- 4568519
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.77
External database links:  
ASAP:
ABE-0014221
ECHOBASE:
EB2464
ECOLIHUB:
mdtM
OU-MICROARRAY:
b4337
STRING:
511145.b4337
COLOMBOS: mdtM


Product      
Name: multidrug efflux pump / bile salt:H+ antiporter / Na+:H+ antiporter / K+:H+ antiporter
Synonym(s): MdtM, MdtM drug MFS transporter, YjiO, multidrug efflux pump MdtM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 44.688
Isoelectric point: 10.613
Motif(s):
 
Type Positions Sequence Comment
12 -> 32 LFFPMALILYDFAAYLSTDLI UniProt: Helical.
22 -> 22 D D → A: binds TPP+ and chloramphenicol with wild-type affinity; loss of resistance to TPP+ and significant decrease in resistance to chloramphenical when overproduced in a ΔmdtM background
23 -> 353 FAAYLSTDLIQPGIINVVRDFNADVSLAPAAVSLYLAGGMALQWLLGPLSDRIGRRPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIATVGYVTVQEAFGQTKGIKLMAIITSIVLIAPIIGPLSGAALMHFMHWKVLFAIIAVMGFISFVGLLLAMPETVKRGAVPFSAKSVLRDFRNVFCNRLFLFGAATISLSYIPMMSWVAVSPVILIDAGSLTTSQFAWTQVPVFGAVIVANAIVARFVKDPTEPRFIWRAVPIQLVGLSLLIVGNLLSPHVWLWSVLGTSLYAFGIGLIFPTLFRFTLFSNKLPKGTVSASLNMVI
26 -> 26 Y Y → A: enhanced affinity for chloramphenicol and TPP+; increased resistance to chloramphenicol and TPP+ when overproduced in a ΔmdtM background
49 -> 69 LAPAAVSLYLAGGMALQWLLG UniProt: Helical.

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015125 - bile acid transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0015299 - solute:proton antiporter activity
GO:0015385 - sodium:proton antiporter activity
GO:0015386 - potassium:proton antiporter activity
biological_process GO:0097623 - potassium ion export across plasma membrane
GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0036376 - sodium ion export across plasma membrane
GO:0046677 - response to antibiotic
GO:0030641 - regulation of cellular pH
GO:0055085 - transmembrane transport
GO:0015721 - bile acid and bile salt transport
GO:0098656 - anion transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Alegre KO., et al., 2015
[2] Alon Cudkowicz N., et al., 2019
[3] Edgar R., et al., 1997
[4] Jindal S., et al., 2019
[5] Schuldiner S. 2018
[6] Shuster Y., et al., 2016
[7] Tal N., et al., 2009
External database links:  
ALPHAFOLD:
P39386
DIP:
DIP-12641N
ECOCYC:
YJIO-MONOMER
ECOLIWIKI:
b4337
INTERPRO:
IPR020846
INTERPRO:
IPR036259
INTERPRO:
IPR011701
INTERPRO:
IPR005829
MODBASE:
P39386
PFAM:
PF07690
PRIDE:
P39386
PRODB:
PRO_000023193
PROSITE:
PS50850
REFSEQ:
NP_418757
SMR:
P39386
UNIPROT:
P39386


Operon      
Name: mdtM-yjiN         
Operon arrangement:
Transcription unit        Promoter
mdtM-yjiN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Alegre KO., Law CJ., 2015, Purification of a Multidrug Resistance Transporter for Crystallization Studies., Antibiotics (Basel) 4(1):113-35

 [2] Alon Cudkowicz N., Schuldiner S., 2019, Deletion of the major Escherichia coli multidrug transporter AcrB reveals transporter plasticity and redundancy in bacterial cells., PLoS One 14(6):e0218828

 [3] Edgar R., Bibi E., 1997, MdfA, an Escherichia coli multidrug resistance protein with an extraordinarily broad spectrum of drug recognition., J Bacteriol 179(7):2274-80

 [4] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [5] Schuldiner S., 2018, The Escherichia coli effluxome., Res Microbiol 169(7-8):357-362

 [6] Shuster Y., Steiner-Mordoch S., Alon Cudkowicz N., Schuldiner S., 2016, A Transporter Interactome Is Essential for the Acquisition of Antimicrobial Resistance to Antibiotics., PLoS One 11(4):e0152917

 [7] Tal N., Schuldiner S., 2009, A coordinated network of transporters with overlapping specificities provides a robust survival strategy., Proc Natl Acad Sci U S A 106(22):9051-6


RegulonDB