RegulonDB RegulonDB 10.9: Gene Form
   

nudF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tolC nudF yqiB SoxS Rob MarA PhoP TSS_3338 TSS_3338 TSS_3337 TSS_3337 TSS_3336 TSS_3336 tolCp4 tolCp4 tolCp3 tolCp3 tolCp2 tolCp2 tolCp1 tolCp1 TSS_3334 TSS_3334 TSS_3333 TSS_3333 TSS_3332 TSS_3332 TSS_3331 TSS_3331

Gene      
Name: nudF    Texpresso search in the literature
Synonym(s): ECK3025, EG12633, aspP, b3034, trgB, yqiE
Genome position(nucleotides): 3177281 <-- 3177910 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.79
External database links:  
ASAP:
ABE-0009961
ECHOBASE:
EB2101
ECOLIHUB:
nudF
OU-MICROARRAY:
b3034
STRING:
511145.b3034
COLOMBOS: nudF


Product      
Name: ADP-sugar pyrophosphatase
Synonym(s): AspP, NudF, TrgB, YqiE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.667
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
59 -> 179 AAVLLPFDPVRDEVVLIEQIRIAAYDTSETPWLLEMVAGMIEEGESVEDVARREAIEEAGLIVKRTKPVLSFLASPGGTSERSSIMVGEVDATTASGIHGLADENEDIRVHVVSREQAYQW
97 -> 118 GMIEEGESVEDVARREAIEEAG
133 -> 135 SPG
28 -> 29 FF
6 -> 6 N

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016462 - pyrophosphatase activity
GO:0016818 - hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0046872 - metal ion binding
GO:0019144 - ADP-sugar diphosphatase activity
GO:0047631 - ADP-ribose diphosphatase activity
GO:0000287 - magnesium ion binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006753 - nucleoside phosphate metabolic process
GO:0009408 - response to heat
GO:0019693 - ribose phosphate metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Liu W., et al., 2015
[2] Song EK., et al., 2005
[3] Wang PH., et al., 2018
[4] Zheng Y., et al., 2013
External database links:  
DIP:
DIP-36214N
ECOCYC:
EG12633-MONOMER
ECOLIWIKI:
b3034
INTERPRO:
IPR004385
INTERPRO:
IPR020084
INTERPRO:
IPR015797
INTERPRO:
IPR000086
MODBASE:
Q93K97
PDB:
1VIQ
PDB:
1G9Q
PDB:
1GA7
PDB:
1KHZ
PDB:
1G0S
PFAM:
PF00293
PRIDE:
Q93K97
PRODB:
PRO_000023424
PROSITE:
PS51462
PROSITE:
PS00893
REFSEQ:
NP_417506
SMR:
Q93K97
UNIPROT:
Q93K97


Operon      
Name: nudF-yqiB-cpdA-yqiA-parE         
Operon arrangement:
Transcription unit        Promoter
nudF-yqiB-cpdA-yqiA-parE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3331 3176921 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3332 3176965 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3333 3177710 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3334 3178001 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3336 3178133 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3337 3178889 forward nd [RS-EPT-CBR] [5]
  promoter TSS_3338 3179055 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Liu W., Zhang R., Tian N., Xu X., Cao Y., Xian M., Liu H., 2015, Utilization of alkaline phosphatase PhoA in the bioproduction of geraniol by metabolically engineered Escherichia coli., Bioengineered 6(5):288-93

 [2] Song EK., Park HJ., Kim JS., Lee HH., Kim UH., Han MK., 2005, A novel fluorometric assay for ADP-ribose pyrophosphatase activity., J Biochem Biophys Methods 63(3):161-9

 [3] Wang PH., Khusnutdinova AN., Luo F., Xiao J., Nemr K., Flick R., Brown G., Mahadevan R., Edwards EA., Yakunin AF., 2018, Biosynthesis and Activity of Prenylated FMN Cofactors., Cell Chem Biol 25(5):560-570.e6

 [4] Zheng Y., Liu Q., Li L., Qin W., Yang J., Zhang H., Jiang X., Cheng T., Liu W., Xu X., Xian M., 2013, Metabolic engineering of Escherichia coli for high-specificity production of isoprenol and prenol as next generation of biofuels., Biotechnol Biofuels 6:57

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB