RegulonDB RegulonDB 10.10: Gene Form
   

mdaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdaB ygiZ ygiN RcsB-BglJ TSS_3328 (cluster) TSS_3328 (cluster) ygiNp2 ygiNp2 mdaBp5 mdaBp5 TSS_3327 TSS_3327 mdaBp1 mdaBp1 mdaBp7 mdaBp7 ygiZp ygiZp ygiZp3 ygiZp3

Gene      
Name: mdaB    Texpresso search in the literature
Synonym(s): ECK3019, EG12656, b3028, mda66
Genome position(nucleotides): 3172530 --> 3173111 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.52
External database links:  
ASAP:
ABE-0009946
ECHOBASE:
EB2524
ECOLIHUB:
mdaB
OU-MICROARRAY:
b3028
STRING:
511145.b3028
COLOMBOS: mdaB


Product      
Name: NADPH:quinone oxidoreductase MdaB
Synonym(s): MdaB, NADPH quinone reductase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.891
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
2 -> 193 SNILIINGAKKFAHSNGQLNDTLTEVADGTLRDLGHDVRIVRADSDYDVKAEVQNFLWADVVIWQMPGWWMGAPWTVKKYIDDVFTEGHGTLYASDGRTRKDPSKKYGSGGLVQGKKYMLSLTWNAPMEAFTEKDQFFHGVGVDGVYLPFHKANQFLGMEPLPTFIANDVIKMPDVPRYTEEYRKHLVEIFG
69 -> 72 GWWM
16 -> 23 SNGQLNDT
3 -> 188 NILIINGAKKFAHSNGQLNDTLTEVADGTLRDLGHDVRIVRADSDYDVKAEVQNFLWADVVIWQMPGWWMGAPWTVKKYIDDVFTEGHGTLYASDGRTRKDPSKKYGSGGLVQGKKYMLSLTWNAPMEAFTEKDQFFHGVGVDGVYLPFHKANQFLGMEPLPTFIANDVIKMPDVPRYTEEYRKHL
124 -> 127 TWNA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0008753 - NADPH dehydrogenase (quinone) activity
External database links:  
ECOCYC:
EG12656-MONOMER
ECOLIWIKI:
b3028
INTERPRO:
IPR029039
INTERPRO:
IPR003680
MODBASE:
P0AEY5
PFAM:
PF02525
PRIDE:
P0AEY5
PRODB:
PRO_000023173
REFSEQ:
NP_417500
SMR:
P0AEY5
UNIPROT:
P0AEY5


Operon      
Name: mdaB         
Operon arrangement:
Transcription unit        Promoter
mdaB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygiZp3 3172253 reverse nd [ICWHO] [1]
  promoter mdaBp7 3172407 forward nd [ICWHO] [1]
  promoter mdaBp1 3172423 forward nd [ICWHO] [1]
  promoter TSS_3327 3172504 forward nd [RS-EPT-CBR] [2]
  promoter mdaBp5 3172506 forward nd [ICWHO] [1]
  promoter ygiNp2 3173078 forward nd [ICWHO] [1]
  promoter TSS_3328 (cluster) 3173120 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB