RegulonDB RegulonDB 10.9: Gene Form
   

fldB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xerD fldB ygfX sdhE SoxS SoxS CpxR CpxR xerDp xerDp fldBp fldBp TSS_3168 TSS_3168 TSS_3167 TSS_3167 dsbCp2 dsbCp2 TSS_3166 TSS_3166

Gene      
Name: fldB    Texpresso search in the literature
Synonym(s): ECK2890, EG12697, b2895
Genome position(nucleotides): 3039855 --> 3040376 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.34
External database links:  
ASAP:
ABE-0009503
ECHOBASE:
EB2559
ECOLIHUB:
fldB
OU-MICROARRAY:
b2895
STRING:
511145.b2895
COLOMBOS: fldB


Product      
Name: flavodoxin 2
Synonym(s): FldB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.7
Isoelectric point: 3.859
Motif(s):
 
Type Positions Sequence
3 -> 165 MGLFYGSSTCYTEMAAEKIRDIIGPELVTLHNLKDDSPKLMEQYDVLILGIPTWDFGEIQEDWEAVWDQLDDLNLEGKIVALYGLGDQLGYGEWFLDALGMLHDKLSTKGVKFVGYWPTEGYEFTSPKPVIADGQLFVGLALDETNQYDLSDERIQSWCEQIL
115 -> 115 F
5 -> 160 LFYGSSTCYTEMAAEKIRDIIGPELVTLHNLKDDSPKLMEQYDVLILGIPTWDFGEIQEDWEAVWDQLDDLNLEGKIVALYGLGDQLGYGEWFLDALGMLHDKLSTKGVKFVGYWPTEGYEFTSPKPVIADGQLFVGLALDETNQYDLSDERIQSW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0009055 - electron transfer activity
GO:0010181 - FMN binding
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Vetter H., et al., 1971
External database links:  
ECOCYC:
FLAVODOXIN2-MONOMER
ECOLIWIKI:
b2895
INTERPRO:
IPR029039
INTERPRO:
IPR010086
INTERPRO:
IPR008254
INTERPRO:
IPR001226
MODBASE:
P0ABY4
PDB:
2MT9
PDB:
2MTB
PFAM:
PF00258
PRIDE:
P0ABY4
PRODB:
PRO_000022636
PROSITE:
PS50902
PROSITE:
PS00201
REFSEQ:
NP_417371
SMR:
P0ABY4
SWISSMODEL:
P0ABY4
UNIPROT:
P0ABY4


Operon      
Name: fldB         
Operon arrangement:
Transcription unit        Promoter
fldB


Transcriptional Regulation      
Display Regulation             
Activated by: SoxS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3166 3038872 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3167 3039766 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3168 3039778 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Vetter H., Knappe J., 1971, Flavodoxin and ferredoxin of Escherichia coli., Hoppe Seylers Z Physiol Chem 352(3):433-46

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB