RegulonDB RegulonDB 10.9: Gene Form
   

exuR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

exuT exuR yqiM CpxR ExuR CRP UxuR ExuR yqjAp2 yqjAp2 TSS_3392 (cluster) TSS_3392 (cluster) yqjAp1 yqjAp1 TSS_3391 (cluster) TSS_3391 (cluster) exuRp2 exuRp2 exuRp exuRp

Gene      
Name: exuR    Texpresso search in the literature
Synonym(s): ECK3085, EG12739, b3094
Genome position(nucleotides): 3246652 --> 3247428 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.58
External database links:  
ASAP:
ABE-0010176
CGSC:
801
ECHOBASE:
EB2595
ECOLIHUB:
exuR
OU-MICROARRAY:
b3094
STRING:
511145.b3094
COLOMBOS: exuR


Product      
Name: DNA-binding transcriptional repressor ExuR
Synonym(s): ExuR, negative regulator of exu regulon, exuT, uxaAC, and uxuB
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GntR
Cellular location: cytosol
Molecular weight: 29.836
Isoelectric point: 5.385
Motif(s):
 
Type Positions Sequence
96 -> 219 ELLQARQLIESNIAEFAATQVTKQDIMKLMAIQEQARGEQCFRDSEWDLQFHIQVALATQNSALAAIVEKMWTQRSHNPYWKKLHEHIDSRTVDNWCDDHDQILKALIRKDPHAAKLAMWQHLE
9 -> 72 LYQQLAADLKERIEQGVYLVGDKLPAERFIADEKNVSRTVVREAIIMLEVEGYVEVRKGSGIHV
35 -> 54 ERFIADEKNVSRTVVREAII
7 -> 75 RRLYQQLAADLKERIEQGVYLVGDKLPAERFIADEKNVSRTVVREAIIMLEVEGYVEVRKGSGIHVVSN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Mata-Gilsinger M., et al., 1983
External database links:  
ECOCYC:
PD03270
ECOLIWIKI:
b3094
INTERPRO:
IPR008920
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR011711
INTERPRO:
IPR000524
MODBASE:
P0ACL2
PFAM:
PF07729
PFAM:
PF00392
PRIDE:
P0ACL2
PRINTS:
PR00035
PRODB:
PRO_000022557
PROSITE:
PS50949
REFSEQ:
NP_417565
SMART:
SM00345
SMART:
SM00895
SMR:
P0ACL2
UNIPROT:
P0ACL2


Operon      
Name: exuR         
Operon arrangement:
Transcription unit        Promoter
exuR


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP, ExuR, UxuR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter exuRp 3246508 forward nd [AIPP], [ICWHO] [2], [3]
  promoter TSS_3391 (cluster) 3246624 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_3392 (cluster) 3247549 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]


Evidence    

 [AIPP] Automated inference of promoter position

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Mata-Gilsinger M., Ritzenthaler P., Blanco C., 1983, Characterization of the operator sites of the exu regulon in Escherichia coli K-12 by operator-constitutive mutations and repressor titration., Genetics 105(4):829-42

 [2] Gama-Castro S., Jimenez-Jacinto V., Peralta-Gil M., Santos-Zavaleta A., Penaloza-Spinola MI., Contreras-Moreira B., Segura-Salazar J., Muniz-Rascado L., Martinez-Flores I., Salgado H., Bonavides-Martinez C., Abreu-Goodger C., Rodriguez-Penagos C., Miranda-Rios J., Morett E., Merino E., Huerta AM., Trevino-Quintanilla L., Collado-Vides J., 2008, RegulonDB (version 6.0): gene regulation model of Escherichia coli K-12 beyond transcription, active (experimental) annotated promoters and Textpresso navigation., Nucleic Acids Res 36(Database issue):D120-4

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB