RegulonDB RegulonDB 10.9: Gene Form
   

mlaD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mlaE mlaC mlaD TSS_3504 TSS_3504 TSS_3503 TSS_3503 TSS_3502 TSS_3502

Gene      
Name: mlaD    Texpresso search in the literature
Synonym(s): ECK3182, EG12799, b3193, yrbD
Genome position(nucleotides): 3337910 <-- 3338461 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.82
External database links:  
ASAP:
ABE-0010493
ECHOBASE:
EB2651
ECOLIHUB:
mlaD
OU-MICROARRAY:
b3193
STRING:
511145.b3193
COLOMBOS: mlaD


Product      
Name: intermembrane phospholipid transport system, substrate binding protein MlaD
Synonym(s): MlaD, YrbD
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 19.576
Isoelectric point: 4.533
Motif(s):
 
Type Positions Sequence
39 -> 116 TYTLYATFDNIGGLKARSPVSIGGVVVGRVADITLDPKTYLPRVTLEIEQRYNHIPDTSSLSIRTSGLLGEQYLALNV
8 -> 28 IWVGIFLLAALLAALFVCLKA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0032991 - protein-containing complex
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0120014 - phospholipid transfer activity
GO:0005515 - protein binding
GO:0005543 - phospholipid binding
GO:0005548 - phospholipid transporter activity
biological_process GO:0120010 - intermembrane phospholipid transfer
GO:0015914 - phospholipid transport
Note(s): Note(s): ...[more].
Reference(s): [1] Hughes GW., et al., 2019
[2] Isom GL., et al., 2020
External database links:  
DIP:
DIP-12906N
ECOCYC:
EG12799-MONOMER
ECOLIWIKI:
b3193
INTERPRO:
IPR030970
INTERPRO:
IPR003399
MINT:
P64604
PDB:
5UW2
PDB:
5UW8
PFAM:
PF02470
PRIDE:
P64604
REFSEQ:
NP_417660
SMR:
P64604
UNIPROT:
P64604


Operon      
Name: mlaFEDCB         
Operon arrangement:
Transcription unit        Promoter
mlaFEDCB
mlaFEDCB
mlaFEDCB


Transcriptional Regulation      
Display Regulation             
Activated by: MarA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3502 3337936 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3503 3338185 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3504 3338787 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hughes GW., Hall SCL., Laxton CS., Sridhar P., Mahadi AH., Hatton C., Piggot TJ., Wotherspoon PJ., Leney AC., Ward DG., Jamshad M., Spana V., Cadby IT., Harding C., Isom GL., Bryant JA., Parr RJ., Yakub Y., Jeeves M., Huber D., Henderson IR., Clifton LA., Lovering AL., Knowles TJ., 2019, Evidence for phospholipid export from the bacterial inner membrane by the Mla ABC transport system., Nat Microbiol 4(10):1692-1705

 [2] Isom GL., Coudray N., MacRae MR., McManus CT., Ekiert DC., Bhabha G., 2020, LetB Structure Reveals a Tunnel for Lipid Transport across the Bacterial Envelope., Cell 181(3):653-664.e19

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB