RegulonDB RegulonDB 10.9: Gene Form
   

yrbG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kdsD yrbG mlaF MarA terminator anti-terminator kdsCp1 kdsCp1 TSS_3508 TSS_3508 kdsCp2 kdsCp2 kdsCp3 kdsCp3 TSS_3506 TSS_3506 TSS_3505 TSS_3505 yrbGp yrbGp mlaFp1 mlaFp1 mlaFp2 mlaFp2 mlaFp3 mlaFp3

Gene      
Name: yrbG    Texpresso search in the literature
Synonym(s): ECK3185, EG12802, b3196
Genome position(nucleotides): 3340275 --> 3341252 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.04
External database links:  
ASAP:
ABE-0010502
ECHOBASE:
EB2654
ECOLIHUB:
yrbG
OU-MICROARRAY:
b3196
STRING:
511145.b3196
COLOMBOS: yrbG


Product      
Name: putative transport protein YrbG
Synonym(s): YrbG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 34.741
Isoelectric point: 5.296
Motif(s):
 
Type Positions Sequence
170 -> 190 GGLPVAFLWLGIALIIMPVAT
175 -> 317 AFLWLGIALIIMPVATRMVVDNATVLANYFAISELTMGLTAIAIGTSLPELATAIAGVRKGENDIAVGNIIGANIFNIVIVLGLPALITPGEIDPLAYSRDYSVMLLVSIIFALLCWRRSPQPGRGVGVLLTGGFIVWLAMLY
6 -> 26 ALLIVGLLLVVYSADRLVFAA
270 -> 290 LAYSRDYSVMLLVSIIFALLC
303 -> 323 VLLTGGFIVWLAMLYWLSPIL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
GO:0005262 - calcium channel activity
GO:0008273 - calcium, potassium:sodium antiporter activity
biological_process GO:0006874 - cellular calcium ion homeostasis
GO:0055085 - transmembrane transport
GO:0035725 - sodium ion transmembrane transport
GO:0071805 - potassium ion transmembrane transport
GO:0098656 - anion transmembrane transport
GO:0070588 - calcium ion transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Hsieh JM., et al., 2010
[2] Jindal S., et al., 2019
External database links:  
ECOCYC:
YRBG-MONOMER
ECOLIWIKI:
b3196
INTERPRO:
IPR004837
INTERPRO:
IPR004481
PANTHER:
PTHR10846
PFAM:
PF01699
PRIDE:
P45394
REFSEQ:
NP_417663
UNIPROT:
P45394


Operon      
Name: yrbG-kdsDC-lptCAB-rpoN-hpf-ptsN-rapZ-npr         
Operon arrangement:
Transcription unit        Promoter
yrbG-kdsD
yrbG-kdsDC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
lptAB
lptAB
lptB-rpoN-hpf-ptsN-yhbJ
rpoN-hpf-ptsN-yhbJ-npr


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3505 3341124 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3506 3341718 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3508 3342094 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hsieh JM., Besserer GM., Madej MG., Bui HQ., Kwon S., Abramson J., 2010, Bridging the gap: a GFP-based strategy for overexpression and purification of membrane proteins with intra and extracellular C-termini., Protein Sci 19(4):868-80

 [2] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB