RegulonDB RegulonDB 10.9: Gene Form
   

yhdX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhdX yhdY yhdW yhdV NtrC NtrC yhdWp yhdWp

Gene      
Name: yhdX    Texpresso search in the literature
Synonym(s): ECK3256, EG12835, b3269
Genome position(nucleotides): 3420134 --> 3421315 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.25
External database links:  
ASAP:
ABE-0010733
ECHOBASE:
EB2684
ECOLIHUB:
yhdX
OU-MICROARRAY:
b3269
STRING:
511145.b3269
COLOMBOS: yhdX


Product      
Name: putative ABC transporter membrane subunit YhdX
Synonym(s): YhdX
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 43.261
Isoelectric point: 10.804
Motif(s):
 
Type Positions Sequence
103 -> 388 SVLGFFIGLARLSDNWLLRKLSTIYIEIFRNIPPLLQIFFWYFAVLRNLPGPRQAVSAFDLAFLSNRGLYIPSPQLGDGFIAFILAVVMAIVLSVGLFRFNKTYQIKTGQLRRTWPIAAVLIIGLPLLAQWLFGAALHWDVPALRGFNFRGGMVLIPELAALTLALSVYTSAFIAEIIRAGIQAVPYGQHEAARSLGLPNPVTLRQVIIPQALRVIIPPLTSQYLNIVKNSSLAAAIGYPDMVSLFAGTVLNQTGQAIETIAMTMSVYLIISLTISLLMNIYNRRI
219 -> 239 IAAVLIIGLPLLAQWLFGAAL
180 -> 200 DGFIAFILAVVMAIVLSVGLF
21 -> 41 AWLFQILAVVAVVGIVGWLFH
363 -> 383 IAMTMSVYLIISLTISLLMNI

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0055085 - transmembrane transport
GO:0071705 - nitrogen compound transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
YHDX-MONOMER
ECOLIWIKI:
b3269
INTERPRO:
IPR035906
INTERPRO:
IPR043429
INTERPRO:
IPR010065
INTERPRO:
IPR000515
PANTHER:
PTHR30614
PFAM:
PF00528
PRIDE:
P45767
PROSITE:
PS50928
REFSEQ:
YP_026209
SMR:
P45767
UNIPROT:
P45767


Operon      
Name: yhdWXYZ         
Operon arrangement:
Transcription unit        Promoter
yhdWXYZ


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB