RegulonDB RegulonDB 10.9: Gene Form
   

yfaL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfaL ubiG ypaB DnaA DnaA Fis CRP Fis ArgP ArgP Fis ArgP ArgP Fis ArgP Fis ArgP H-NS H-NS CspA terminator anti-anti-terminator anti-terminator yfaLp7 yfaLp7 yfaLp3 yfaLp3 yfaLp1 yfaLp1 yfaLp8 yfaLp8

Gene      
Name: yfaL    Texpresso search in the literature
Synonym(s): ECK2225, EG12850, b2233, yfaF, yfaJ, yfaK
Genome position(nucleotides): 2340417 <-- 2344169 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.37
External database links:  
ASAP:
ABE-0007377
ECHOBASE:
EB2695
ECOLIHUB:
yfaL
OU-MICROARRAY:
b2233
STRING:
511145.b2233
COLOMBOS: yfaL


Product      
Name: putative autotransporter adhesin YfaL
Synonym(s): YfaF, YfaJ, YfaK, YfaL
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,outer membrane,extracellular space
Molecular weight: 131.153
Isoelectric point: 3.77
Motif(s):
 
Type Positions Sequence
1 -> 28 MRIIFLRKEYLSLLPSMIASLFSANGVA
28 -> 30 AAV
29 -> 1250 AVTDSCQGYDVKASCQASRQSLSGITQDWSIADGQWLVFSDMTNNASGGAVFLQQGAEFSLLPENETGMTLFANNTVTGEYNNGGAIFAKENSTLNLTDVIFSGNVAGGYGGAIYSSGTNDTGAVDLRVTNAMFRNNIANDGKGGAIYTINNDVYLSDVIFDNNQAYTSTSYSDGDGGAIDVTDNNSDSKHPSGYTIVNNTAFTNNTAEGYGGAIYTNSVTAPYLIDISVDDSYSQNGGVLVDENNSAAGYGDGPSSAAGGFMYLGLSEVTFDIADGKTLVIGNTENDGAVDSIAGTGLITKTGSGDLVLNADNNDFTGEMQIENGEVTLGRSNSLMNVGDTHCQDDPQDCYGLTIGSIDQYQNQAELNVGSTQQTFVHALTGFQNGTLNIDAGGNVTVNQGSFAGIIEGAGQLTIAQNGSYVLAGAQSMALTGDIVVDDGAVLSLEGDAADLTALQDDPQSIVLNGGVLDLSDFSTWQSGTSYNDGLEVSGSSGTVIGSQDVVDLAGGDNLHIGGDGKDGVYVVVDASDGQVSLANNNSYLGTTQIASGTLMVSDNSQLGDTHYNRQVIFTDKQQESVMEITSDVDTRSDAAGHGRDIEMRADGEVAVDAGVDTQWGALMADSSGQHQDEGSTLTKTGAGTLELTASGTTQSAVRVEEGTLKGDVADILPYASSLWVGDGATFVTGADQDIQSIDAISSGTIDISDGTVLRLTGQDTSVALNASLFNGDGTLVNATDGVTLTGELNTNLETDSLTYLSNVTVNGNLTNTSGAVSLQNGVAGDTLTVNGDYTGGGTLLLDSELNGDDSVSDQLVMNGNTAGNTTVVVNSITGIGEPTSTGIKVVDFAADPTQFQNNAQFSLAGSGYVNMGAYDYTLVEDNNDWYLRSQEVTPPSPPDPDPTPDPDPTPDPDPTPDPEPTPAYQPVLNAKVGGYLNNLRAANQAFMMERRDHAGGDGQTLNLRVIGGDYHYTAAGQLAQHEDTSTVQLSGDLFSGRWGTDGEWMLGIVGGYSDNQGDSRSNMTGTRADNQNHGYAVGLTSSWFQHGNQKQGAWLDSWLQYAWFSNDVSEQEDGTDHYHSSGIIASLEAGYQWLPGRGVVIEPQAQVIYQGVQQDDFTAANRARVSQSQGDDIQTRLGLHSEWRTAVHVIPTLDLNYYHDPHSTEIEEDGSTISDDAVKQRGEIKVGVTGNISQRVSLRGSVAWQKGSDDFAQTAGFLSMTVKW
853 -> 853 V
933 -> 934 DP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
GO:0042597 - periplasmic space
GO:0005576 - extracellular region
GO:0009986 - cell surface
molecular_function GO:0015475 - adhesin autotransporter activity
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0008236 - serine-type peptidase activity
biological_process GO:0006508 - proteolysis
GO:0009411 - response to UV
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Chauhan A., et al., 2013
[2] Roux A., et al., 2005
[3] Wells TJ., et al., 2010
External database links:  
ECOCYC:
EG12850-MONOMER
ECOLIWIKI:
b2233
INTERPRO:
IPR012332
INTERPRO:
IPR036709
INTERPRO:
IPR013425
INTERPRO:
IPR011050
INTERPRO:
IPR006315
INTERPRO:
IPR005546
INTERPRO:
IPR003368
PFAM:
PF18883
PFAM:
PF03797
PFAM:
PF02415
PFAM:
PF12951
PRIDE:
P45508
PROSITE:
PS51208
REFSEQ:
NP_416736
SMART:
SM00869
UNIPROT:
P45508


Operon      
Name: yfaL         
Operon arrangement:
Transcription unit        Promoter
yfaL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfaLp8 2344207 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yfaLp1 2344218 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yfaLp3 2344265 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yfaLp7 2344284 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chauhan A., Sakamoto C., Ghigo JM., Beloin C., 2013, Did I pick the right colony? Pitfalls in the study of regulation of the phase variable antigen 43 adhesin., PLoS One 8(9):e73568

 [2] Roux A., Beloin C., Ghigo JM., 2005, Combined inactivation and expression strategy to study gene function under physiological conditions: application to identification of new Escherichia coli adhesins., J Bacteriol 187(3):1001-13

 [3] Wells TJ., Totsika M., Schembri MA., 2010, Autotransporters of Escherichia coli: a sequence-based characterization., Microbiology 156(Pt 8):2459-69

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB