RegulonDB RegulonDB 10.9: Gene Form
   

yajI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yajI    Texpresso search in the literature
Synonym(s): ECK0406, EG12874, b0412
Genome position(nucleotides): 432312 <-- 432851 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.59
External database links:  
ASAP:
ABE-0001433
ECHOBASE:
EB2712
ECOLIHUB:
yajI
OU-MICROARRAY:
b0412
STRING:
511145.b0412
COLOMBOS: yajI


Product      
Name: putative lipoprotein YajI
Synonym(s): YajI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 19.56
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
20 -> 179 CVQQSEVRQMKHSVSTLNQEMTQLNQETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDADGTTLTLRIQGESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISVDQLGFVRIHDIQPVMQ
1 -> 19 MNTNVFRLLLLGSLFSLSA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12874-MONOMER
ECOLIWIKI:
b0412
INTERPRO:
IPR037125
INTERPRO:
IPR021658
PDB:
2JWY
PFAM:
PF11622
PRIDE:
P46122
PROSITE:
PS51257
REFSEQ:
NP_414946
SMR:
P46122
UNIPROT:
P46122


Operon      
Name: yajI         
Operon arrangement:
Transcription unit        Promoter
yajI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_524 432002 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_525 432185 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_526 432975 forward nd [RS-EPT-CBR] [1]
  promoter yajIp6 433034 reverse Similarity to the consensus
Read more >
[ICWHO] [2]



RegulonDB