RegulonDB RegulonDB 10.8: Gene Form
   

zapA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygfB zapA ssrS TSS_3191 (cluster) TSS_3191 (cluster) ssrSp1 ssrSp1 TSS_3189 TSS_3189 TSS_3188 TSS_3188 ssrSp2 ssrSp2 TSS_3186 TSS_3186 TSS_3185 TSS_3185 zapAp3 zapAp3 TSS_3184 (cluster) TSS_3184 (cluster) ygfBp ygfBp

Gene      
Name: zapA    Texpresso search in the literature
Synonym(s): ECK2905, EG12878, b2910, ygfE
Genome position(nucleotides): 3055612 --> 3055941 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.67
External database links:  
ASAP:
ABE-0009554
ECHOBASE:
EB2716
OU-MICROARRAY:
b2910
PortEco:
zapA
STRING:
511145.b2910
COLOMBOS: zapA


Product      
Name: cell division protein ZapA
Synonym(s): YgfE, ZapA, cell division factor ZapA, localizes to the cytokinetic ring
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 12.594
Isoelectric point: 4.876
Motif(s):
 
Type Positions Sequence
6 -> 90 VDIQIFGRSLRVNCPPDQRDALNQAADDLNQRLQDLKERTRVTNTEQLVFIAALNISYELAQEKAKTRDYAASMEQRIRMLQQTI
14 -> 14 S

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
GO:0032153 - cell division site
GO:0030428 - cell septum
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
GO:0000921 - septin ring assembly
GO:0090529 - cell septum assembly
Note(s): Note(s): ...[more].
Reference(s): [1] Abe A., et al., 2013
External database links:  
ECOCYC:
EG12878-MONOMER
ECOLIWIKI:
b2910
INTERPRO:
IPR036192
INTERPRO:
IPR023771
INTERPRO:
IPR007838
MODBASE:
P0ADS2
PANTHER:
PTHR34981
PDB:
4P1M
PFAM:
PF05164
PRIDE:
P0ADS2
PRODB:
PRO_000024245
REFSEQ:
NP_417386
SMR:
P0ADS2
UNIPROT:
P0ADS2


Operon      
Name: zapA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3184 (cluster) 3055487 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter zapAp3 3055551 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_3185 3055639 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3186 3055757 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3188 3055764 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3189 3055899 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3191 (cluster) 3055983 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Abe A., Furukawa S., Migita Y., Tanaka M., Ogihara H., Morinaga Y., 2013, Sublethal high hydrostatic pressure treatment reveals the importance of genes coding cytoskeletal protein in Escherichia coli morphogenesis., Curr Microbiol 67(5):515-21

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB