RegulonDB RegulonDB 10.9: Gene Form
   

feoC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

feoB rpnA feoC feoA terminator anti-terminator yhgAp6 yhgAp6 TSS_4010 TSS_4010 TSS_4009 TSS_4009 TSS_4008 (cluster) TSS_4008 (cluster) TSS_4007 TSS_4007

Gene      
Name: feoC    Texpresso search in the literature
Synonym(s): ECK3397, EG12933, b3410, yhgG
Genome position(nucleotides): 3542728 --> 3542964 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.85
External database links:  
ASAP:
ABE-0011130
ECHOBASE:
EB2769
ECOLIHUB:
feoC
OU-MICROARRAY:
b3410
STRING:
511145.b3410
COLOMBOS: feoC


Product      
Name: ferrous iron transport protein FeoC
Synonym(s): FeoC, YhgG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.66
Isoelectric point: 7.922
Motif(s):
 
Type Positions Sequence
3 -> 69 SLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGSCKSCPEGKA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0005506 - iron ion binding
biological_process GO:0033212 - iron import into cell
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12933-MONOMER
ECOLIWIKI:
b3410
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR023732
INTERPRO:
IPR015102
PDB:
1XN7
PFAM:
PF09012
PRIDE:
P64638
PRODB:
PRO_000022599
REFSEQ:
NP_417869
SMR:
P64638
UNIPROT:
P64638


Operon      
Name: feoABC         
Operon arrangement:
Transcription unit        Promoter
feoABC


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, OmpR
Repressed by: Fur
Undetermined regulation NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4007 3540444 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4008 (cluster) 3540462 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4009 3540588 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4010 3542195 forward nd [RS-EPT-CBR] [1]
  promoter yhgAp6 3543147 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB