RegulonDB RegulonDB 10.9: Gene Form
   

mngB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mngB mngA cydA ArcA Cra Cra ArcA FNR FNR ArcA ArcA ArcA ArcA TSS_876 TSS_876 TSS_875 TSS_875 TSS_874 TSS_874 TSS_873 TSS_873 TSS_872 TSS_872 TSS_871 TSS_871 TSS_870 TSS_870 TSS_869 TSS_869 TSS_868 TSS_868 TSS_867 TSS_867 TSS_866 TSS_866 TSS_865 TSS_865 cydAp5 cydAp5 TSS_864 TSS_864 cydAp2 cydAp2 TSS_862 TSS_862 cydAp4 cydAp4 cydAp3 cydAp3 cydAp1 cydAp1 mngBp mngBp mngBp2 mngBp2

Gene      
Name: mngB    Texpresso search in the literature
Synonym(s): ECK0720, EG13236, b0732, ybgG
Genome position(nucleotides): 767978 --> 770611 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.35
External database links:  
ASAP:
ABE-0002495
ECHOBASE:
EB3025
ECOLIHUB:
mngB
OU-MICROARRAY:
b0732
STRING:
511145.b0732
COLOMBOS: mngB


Product      
Name: α-mannosidase
Synonym(s): MngB, YbgG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 100.015
Isoelectric point: 5.359
Motif(s):
 
Type Positions Sequence
490 -> 706 LENAFWQIALNEDGSLQLVDKDSGVRYDRVLQIEESSDDGDEYDYSPAKEEWVITAANAKPQCDIIHEAWQSRAVIRYDMAVPLNLSERSARQSTGRVGVVLVVTLSHNSRRIDVDINLDNQADDHRLRVLVPTPFNTDSVLADTQFGSLTRPVNDSAMNNWQQEGWKEAPVPVWNMLNYVALQEGRNGMAVFSEGLREFEVIGEEKKTFAITLLRG
87 -> 100 WYTQTDTTIVSAES
7 -> 269 VHITPHMHWDREWYFTTEESRILLVNNMEEILCRLEQDNEYKYYVLDGQTAILEDYFAVKPENKDRVKKQVEAGKLIIGPWYTQTDTTIVSAESIVRNLMYGMRDCLAFGEPMKIGYLPDSFGMSGQLPHIYNGFGITRTMFWRGCSERHGTDKTEFLWQSSDGSEVTAQVLPLGYAIGKYLPADENGLRKRLDSYFDVLEKASVTKEILLPNGHDQMPLQQNIFEVMDKLREIYPQRKFVMSRFEEVFEKIEAQRDNLATLK
280 -> 375 VHRTIGSTRMDIKIAHARIENKIVNLLEPLATLAWTLGFEYHHGLLEKMWKEILKNHAHDSIGCCCSDKVHREIVARFELAEDMADNLIRFYMRKI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0030246 - carbohydrate binding
GO:0004559 - alpha-mannosidase activity
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0009313 - oligosaccharide catabolic process
GO:0006013 - mannose metabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH38
ECOCYC:
EG13236-MONOMER
ECOLIWIKI:
b0732
INTERPRO:
IPR011682
INTERPRO:
IPR037094
INTERPRO:
IPR028995
INTERPRO:
IPR027291
INTERPRO:
IPR000602
INTERPRO:
IPR011013
INTERPRO:
IPR011330
INTERPRO:
IPR015341
MODBASE:
P54746
PFAM:
PF01074
PFAM:
PF07748
PFAM:
PF09261
PRIDE:
P54746
PRODB:
PRO_000023252
REFSEQ:
NP_415260
SMART:
SM00872
SMR:
P54746
UNIPROT:
P54746


Operon      
Name: mngAB         
Operon arrangement:
Transcription unit        Promoter
mngAB
mngB
mngB


Transcriptional Regulation      
Display Regulation             
Repressed by: MngR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_862 771280 forward nd [RS-EPT-CBR] [1]
  promoter TSS_864 771302 forward nd [RS-EPT-CBR] [1]
  promoter TSS_865 771369 forward nd [RS-EPT-CBR] [1]
  promoter TSS_866 771383 forward nd [RS-EPT-CBR] [1]
  promoter TSS_867 771385 forward nd [RS-EPT-CBR] [1]
  promoter TSS_868 771778 forward nd [RS-EPT-CBR] [1]
  promoter TSS_869 771784 forward nd [RS-EPT-CBR] [1]
  promoter TSS_870 771797 forward nd [RS-EPT-CBR] [1]
  promoter TSS_871 771799 forward nd [RS-EPT-CBR] [1]
  promoter TSS_872 771802 forward nd [RS-EPT-CBR] [1]
  promoter TSS_873 771808 forward nd [RS-EPT-CBR] [1]
  promoter TSS_874 772115 forward nd [RS-EPT-CBR] [1]
  promoter TSS_875 772368 forward nd [RS-EPT-CBR] [1]
  promoter TSS_876 772487 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB