RegulonDB RegulonDB 10.9: Gene Form
   

eutC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutB eutC eutL terminator anti-terminator

Gene      
Name: eutC    Texpresso search in the literature
Synonym(s): ECK2435, EG50007, b2440
Genome position(nucleotides): 2556410 <-- 2557297 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.64
External database links:  
ASAP:
ABE-0008043
ECHOBASE:
EB4300
ECOLIHUB:
eutC
OU-MICROARRAY:
b2440
STRING:
511145.b2440
COLOMBOS: eutC


Product      
Name: ethanolamine ammonia-lyase subunit β
Synonym(s): EutC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.782
Isoelectric point: 6.751
Motif(s):
 
Type Positions Sequence
65 -> 293 DVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009350 - ethanolamine ammonia-lyase complex
molecular_function GO:0016829 - lyase activity
GO:0008851 - ethanolamine ammonia-lyase activity
GO:0031419 - cobalamin binding
biological_process GO:0006520 - cellular amino acid metabolic process
GO:0046336 - ethanolamine catabolic process
External database links:  
ECOCYC:
EUTC-MONOMER
ECOLIWIKI:
b2440
INTERPRO:
IPR009246
INTERPRO:
IPR042251
INTERPRO:
IPR042255
PANTHER:
PTHR39330
PDB:
3ABQ
PDB:
5YSR
PDB:
5YSN
PDB:
3AO0
PDB:
3ANY
PDB:
3ABS
PDB:
3ABO
PDB:
3ABR
PFAM:
PF05985
PRIDE:
P19636
PRODB:
PRO_000022537
REFSEQ:
NP_416935
SMR:
P19636
UNIPROT:
P19636


Operon      
Name: eutBCLKR         
Operon arrangement:
Transcription unit        Promoter
eutBCLKR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB