RegulonDB RegulonDB 10.10: Gene Form
   

hokA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insJK insK insJ cspA mokA hokA ysaE Cis-reg; thermoregulator TSS_4162 TSS_4162 insKp insKp hokAp6 hokAp6 insJp4 insJp4 TSS_4161 TSS_4161

Gene      
Name: hokA    Texpresso search in the literature
Synonym(s): ECK3544, G0-9613, b4455, yiaZ
Genome position(nucleotides): 3720448 <-- 3720600 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
35.29
External database links:  
ASAP:
ABE-0047285
ECHOBASE:
EB2250
ECOLIHUB:
hokA
STRING:
511145.b4455
COLOMBOS: hokA


Product      
Name: small toxic polypeptide
Synonym(s): HokA, YiaZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 5.998
Isoelectric point: 8.053
Motif(s):
 
Type Positions Sequence
5 -> 46 YRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLAC
7 -> 24 LLSLIVICFTLLFFTWMI
1 -> 2 MP

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
Reference(s): [1] Pedersen K., et al., 1999
External database links:  
ECOCYC:
MONOMER0-1605
ECOLIWIKI:
b4455
INTERPRO:
IPR018084
INTERPRO:
IPR000021
PFAM:
PF01848
PRIDE:
P37305
PRINTS:
PR00281
PRODB:
PRO_000022914
PROSITE:
PS00556
REFSEQ:
YP_026229
UNIPROT:
P37305


Operon      
Name: hokA         
Operon arrangement:
Transcription unit        Promoter
hokA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4161 3720104 forward nd [RS-EPT-CBR] [2]
  promoter insJp4 3720594 forward nd [ICWHO] [3]
  promoter hokAp6 3720810 reverse nd [ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Pedersen K., Gerdes K., 1999, Multiple hok genes on the chromosome of Escherichia coli., Mol Microbiol 32(5):1090-102

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB