RegulonDB RegulonDB 10.9: Gene Form
   

yajL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thiI panE yajL yajQ terminator anti-terminator yajQp yajQp TSS_544 TSS_544 TSS_543 TSS_543 TSS_542 (cluster) TSS_542 (cluster) TSS_541 (cluster) TSS_541 (cluster) TSS_540 TSS_540 yajLp2 yajLp2

Gene      
Name: yajL    Texpresso search in the literature
Synonym(s): ECK0418, G198, b0424, thiJ
Genome position(nucleotides): 443051 <-- 443641 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.51
External database links:  
ASAP:
ABE-0001472
ECHOBASE:
EB3057
ECOLIHUB:
yajL
MIM:
168600
MIM:
606324
OU-MICROARRAY:
b0424
STRING:
511145.b0424
COLOMBOS: yajL


Product      
Name: protein/nucleic acid deglycase 3
Synonym(s): Maillard deglycase 3, ThiJ, YajL, chaperone, protecting proteins in response to oxidative stress
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.777
Isoelectric point: 5.016
Motif(s):
 
Type Positions Sequence
4 -> 170 SALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAIDFGLKIID
106 -> 106 C
47 -> 47 C

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0042803 - protein homodimerization activity
GO:0036524 - protein deglycase activity
biological_process GO:0106046 - guanine deglycation, glyoxal removal
GO:0036529 - protein deglycation, glyoxal removal
GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0009408 - response to heat
GO:0030091 - protein repair
GO:0042254 - ribosome biogenesis
GO:0042026 - protein refolding
GO:0034599 - cellular response to oxidative stress
GO:0036525 - protein deglycation
External database links:  
ECOCYC:
HMP-KIN-MONOMER
ECOLIWIKI:
b0424
INTERPRO:
IPR006287
INTERPRO:
IPR029062
INTERPRO:
IPR002818
MODBASE:
Q46948
PDB:
2AB0
PDB:
5SY4
PFAM:
PF01965
PRIDE:
Q46948
PRODB:
PRO_000024059
REFSEQ:
NP_414958
SMR:
Q46948
UNIPROT:
Q46948


Operon      
Name: panE-yajL         
Operon arrangement:
Transcription unit        Promoter
panE-yajL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yajLp2 443748 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_540 443792 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_541 (cluster) 444555 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_542 (cluster) 444561 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_543 444600 forward nd [RS-EPT-CBR] [2]
  promoter TSS_544 444603 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB