RegulonDB RegulonDB 11.0: Gene Form

flgM gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

flgA flgN flgM CsgD CsgD  OmrB  OmrA TSS_1343 TSS_1343 flgMp flgMp TSS_1342 TSS_1342 flgNp1 flgNp1

Name: flgM    Texpresso search in the literature
Synonym(s): ECK1056, G369, b1071
Genome position(nucleotides): 1129835 <-- 1130128
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: anti-sigma factor for FliA (σ28)
Synonym(s): FlgM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.341
Isoelectric point: 5.054
Type Positions Sequence Comment
1 -> 39 MSIDRTSPLKPVSTVQPRETTDAPVTNSRAAKTTASTST UniProt: Disordered; Sequence Annotation Type: region of interest.


Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> - sigma factors, anti-sigmafactors
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016989 - sigma factor antagonist activity
biological_process GO:0045892 - negative regulation of transcription, DNA-templated
GO:0044781 - bacterial-type flagellum organization
GO:0045861 - negative regulation of proteolysis
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Barembruch C., et al., 2007
[2] Dudin O., et al., 2013
[3] Heel T., et al., 2013
External database links:  

Name: flgAMN         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC
Repressed by: CsgD

Regulation by small RNA    
  Display Regulation
small RNA omrB, omrA

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter flgNp1 1129914 reverse nd [ICWHO] [4]
  promoter TSS_1342 1130164 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1343 1130193 reverse nd [RS-EPT-CBR] [5]


 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Barembruch C., Hengge R., 2007, Cellular levels and activity of the flagellar sigma factor FliA of Escherichia coli are controlled by FlgM-modulated proteolysis., Mol Microbiol 65(1):76-89

 [2] Dudin O., Lacour S., Geiselmann J., 2013, Expression dynamics of RpoS/Crl-dependent genes in Escherichia coli., Res Microbiol 164(8):838-47

 [3] Heel T., Vogel GF., Lammirato A., Schneider R., Auer B., 2013, FlgM as a secretion moiety for the development of an inducible type III secretion system., PLoS One 8(3):e59034

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
