RegulonDB RegulonDB 10.9: Gene Form
   

insL1 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dnaJ insL1 unknown hokC mokC TSS_40 TSS_40 TSS_39 TSS_39 insLp6 insLp6 insLp5 insLp5

Gene      
Name: insL1    Texpresso search in the literature
Synonym(s): ECK0016, G6083, b0016, yi81-1
Genome position(nucleotides): 15445 --> 16557 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.93
External database links:  
ASAP:
ABE-0000058
ECOLIHUB:
insL-1
OU-MICROARRAY:
b0016
STRING:
511145.b2394
COLOMBOS: insL1


Product      
Name: IS186/IS421 transposase
Synonym(s): InsL1
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.909
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
121 -> 121 A
354 -> 370 QPSLDFPPRSAGSEKKN
107 -> 348 SGKRLRLVDGTAISAPGGGSAEWRLHMGYDPHTCQFTDFELTDSRDAERLDRFAQTADEIRIADRGFGSRPECIRSLAFGEADYIVRVHWRGLRWLTAEGMRFDMMGFLRGLDCGKNGETTVMIGNSGNKKAGAPFPARLIAVSLPPEKALISKTRLLSENRRKGRVVQAETLEAAGHVLLLTSLPEDEYSAEQVADCYRLRWQIELAFKRLKSLLHLDALRAKEPELAKAWIFANLLAAFL
126 -> 126 S

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6083-MONOMER
ECOLIWIKI:
b0016
INTERPRO:
IPR002559
INTERPRO:
IPR014736
INTERPRO:
IPR012337
MODBASE:
P0CF91
PFAM:
PF01609
PRIDE:
P0CF91
REFSEQ:
NP_414557
UNIPROT:
P0CF91


Operon      
Name: insL1         
Operon arrangement:
Transcription unit        Promoter
insL1


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insLp5 15380 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter insLp6 15436 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_39 15463 forward nd [RS-EPT-CBR] [2]
  promoter TSS_40 15553 forward nd [RS-EPT-CBR] [2]
  promoter hokCp4 16951 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB