RegulonDB RegulonDB 10.9: Gene Form
   

yagG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yagF yagH yagG terminator anti-terminator anti-anti-terminator yagGp8 yagGp8 yagGp7 yagGp7 yagGp6 yagGp6 yagGp9 yagGp9

Gene      
Name: yagG    Texpresso search in the literature
Synonym(s): ECK0271, G6142, b0270
Genome position(nucleotides): 285395 --> 286777 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
62.47
External database links:  
ASAP:
ABE-0000929
ECHOBASE:
EB3130
ECOLIHUB:
yagG
ECOO157CYC:
Z5001
OU-MICROARRAY:
b0270
STRING:
511145.b0270
COLOMBOS: yagG


Product      
Name: CP4-6 prophage; putative D-xylonate transporter YagG
Synonym(s): YagG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 50.632
Isoelectric point: 8.507
Motif(s):
 
Type Positions Sequence
151 -> 171 FLAAAGSLAISGIALPLVSII
10 -> 30 IGYGLGDTACGFVWQATMFLL
107 -> 127 IIYACVTYILLTLVYTFVNVP
406 -> 426 ILFCVVPVVLYAGMFIMLSLY
11 -> 430 GYGLGDTACGFVWQATMFLLAYFYTDVFGLSAGIMGTLFLVSRVLDAVTDPLMGLLVDRTRTRHGQFRPFLLWGAIPFGIVCVLTFYTPDFSAQGKIIYACVTYILLTLVYTFVNVPYCAMPGVITADPKERHALQSWRFFLAAAGSLAISGIALPLVSIIGKGDEQVGYFGAMCVLGLSGVVLLYVCFFTTKERYTFEVQPGSSVAKDLKLLLGNSQWRIMCAFKMMATCSNVVRGGATLYFVKYVMDHPELATQFLLYGSLATMFGSLCSSRLLGRFDRVTAFKWIIVAYSLISLLIFVTPAEHIALIFALNILFLFVFNTTTPLQWLMASDVVDYEESRSGRRLDGLVFSTYLFSLKIGLAIGGAVVGWILAYVNYSASSSVQPVEVLTTIKILFCVVPVVLYAGMFIMLSLYKLTD

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015293 - symporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0006814 - sodium ion transport
GO:0055085 - transmembrane transport
GO:0071702 - organic substance transport
Note(s): Note(s): ...[more].
Reference(s): [1] Laikova ON., et al., 2001
External database links:  
DIP:
DIP-11234N
ECOCYC:
B0270-MONOMER
ECOLIWIKI:
b0270
ECOO157CYC:
Z5001-MONOMER
INTERPRO:
IPR039672
INTERPRO:
IPR018043
INTERPRO:
IPR001927
INTERPRO:
IPR036259
MODBASE:
P75683
PANTHER:
PTHR11328
PFAM:
PF13347
PRIDE:
P75683
PROSITE:
PS00872
REFSEQ:
NP_414804
UNIPROT:
P75683


Operon      
Name: yagGH         
Operon arrangement:
Transcription unit        Promoter
yagGH


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yagGp9 285207 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yagGp6 285271 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yagGp7 285350 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yagGp8 285353 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Laikova ON., Mironov AA., Gelfand MS., 2001, Computational analysis of the transcriptional regulation of pentose utilization systems in the gamma subdivision of Proteobacteria., FEMS Microbiol Lett 205(2):315-22

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB