RegulonDB RegulonDB 10.9: Gene Form
   

yagH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yagH yagG xynR

Gene      
Name: yagH    Texpresso search in the literature
Synonym(s): ECK0272, G6143, b0271
Genome position(nucleotides): 286789 --> 288399 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
64.37
External database links:  
ASAP:
ABE-0000931
ECHOBASE:
EB3131
ECOLIHUB:
yagH
OU-MICROARRAY:
b0271
STRING:
511145.b0271
COLOMBOS: yagH


Product      
Name: CP4-6 prophage; putative xylosidase/arabinosidase
Synonym(s): YagH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 60.825
Isoelectric point: 5.512
Motif(s):
 
Type Positions Sequence
3 -> 303 ITNPILTGFNPDPSLCRQGEDYYIATSTFEWFPGVRIYHSRDLKNWSLVSTPLDRVSMLDMKGNPDSGGIWAPCLSYADGKFWLLYTDVKIVDSPWKNGRNFLVTAPSIEGPWSEPIPMGNGGFDPSLFHDDDGRKYYIYRPWGPRHHSNPHNTIVLQAFDPQTGTLSPERKTLFTGTPLCYTEGAHLYRHAGWYYLMAAEGGTSYEHAVVVLRSKNIDGPYELHPDVTMMTSWHLPENPLQKSGHGSLLQTHTGEWYMAYLTSRPLRLPGVPLLASGGRGYCPLGRETGIARIEWRDGWP
332 -> 534 RDDFDASSLDPELQTLRIPFDDTLGSLTARPGFLRLYGNDSLNSTFTQSTVARRWQHFAFRAETRMEFSPVHFQQSAGLTCYYNSKNWSYCFVDYEEGQGRTIKVIQLDHNVPSWPLHEQPIPVPEHAESVWLRVDVDTLVYRYSYSFDGETWHTVPVTYEAWKLSDDYIGGRGFFTGAFVGLHCEDISGDGCYADFDYFTYE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0009044 - xylan 1,4-beta-xylosidase activity
biological_process GO:0008152 - metabolic process
GO:0000272 - polysaccharide catabolic process
GO:0005975 - carbohydrate metabolic process
GO:0045493 - xylan catabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH43
ECOCYC:
G6143-MONOMER
ECOLIWIKI:
b0271
INTERPRO:
IPR006710
INTERPRO:
IPR013320
INTERPRO:
IPR023296
INTERPRO:
IPR041542
MODBASE:
P77713
PFAM:
PF17851
PFAM:
PF04616
PRIDE:
P77713
REFSEQ:
NP_414805
SMR:
P77713
SWISSMODEL:
P77713
UNIPROT:
P77713


Operon      
Name: yagGH         
Operon arrangement:
Transcription unit        Promoter
yagGH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB