RegulonDB RegulonDB 10.9: Gene Form
   

yagP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paoC paoD yagP nc1 paoB

Gene      
Name: yagP    Texpresso search in the literature
Synonym(s): ECK0281, G6153, b0282, b4695, ykgT
Genome position(nucleotides): 297381 <-- 297791 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.55
External database links:  
ASAP:
ABE-0000982
ECHOBASE:
EB3325
ECOLIHUB:
yagP
ECOO157CYC:
Z0342
ECOO157CYC:
Z0346
OU-MICROARRAY:
b0282
STRING:
316407.85674426
COLOMBOS: yagP


Product      
Name: putative LysR family substrate binding domain-containing protein YagP
Synonym(s): YagP, YkgT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.411
Isoelectric point: 8.697
Motif(s):
 
Type Positions Sequence
25 -> 131 HKCIGWRQSPEVAPYRWPFEENGRTFDLAIEPQITTNDLRLMLRLALAGGGITIATQETFRPYIESGKLVSLLDDFLPQFPGFYLYFPQRRNIAPKLRALIDYVKEW

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6153-MONOMER
ECOLIWIKI:
b0282
ECOO157CYC:
Z0342-MONOMER
ECOO157CYC:
Z0346-MONOMER
INTERPRO:
IPR005119
MODBASE:
P75684
PFAM:
PF03466
PRIDE:
P75684
REFSEQ:
NP_414816
SMR:
P75684
UNIPROT:
P75684


Operon      
Name: yagP         
Operon arrangement:
Transcription unit        Promoter
yagP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB