RegulonDB RegulonDB 10.9: Gene Form
   

paoD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

paoC paoD yagP nc1 paoB

Gene      
Name: paoD    Texpresso search in the literature
Synonym(s): ECK0282, G6154, b0283, yagQ
Genome position(nucleotides): 297770 <-- 298726 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
59.98
External database links:  
ASAP:
ABE-0000984
ECHOBASE:
EB3326
ECOLIHUB:
yagQ
OU-MICROARRAY:
b0283
STRING:
511145.b0283
COLOMBOS: paoD


Product      
Name: molybdenum cofactor insertion chaperone PaoD
Synonym(s): PaoD, YagQ, molybdenum cofactor insertion chaperone for PaoABC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.954
Isoelectric point: 6.839
Motif(s):
 
Type Positions Sequence
180 -> 301 LMIYGRSLEAQATASLAAATGYDSHIFDLFPASASAQIDTDTAVILLCHDLNRELPVLQAAREAKPFYLGALGSYRTHTLRLQKLHELGWSREETTQIRAPVGIFPKARDAHTLALSVLAEV
36 -> 101 MSGKGAVLVTLVEIRGGAARPLGAQMVVREDGRYCGFVSGGCVEAAAAFEALEMMGSGRDREIRYG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0042803 - protein homodimerization activity
GO:0043546 - molybdopterin cofactor binding
External database links:  
ECOCYC:
G6154-MONOMER
ECOLIWIKI:
b0283
INTERPRO:
IPR027051
INTERPRO:
IPR003777
PFAM:
PF02625
PFAM:
PF13478
PRIDE:
P77183
REFSEQ:
NP_414817
SMR:
P77183
UNIPROT:
P77183


Operon      
Name: paoABCD         
Operon arrangement:
Transcription unit        Promoter
paoABCD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB