RegulonDB RegulonDB 10.9: Gene Form
   

mhpE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mhpT mhpE mhpF mhpD NsrR mhpTp mhpTp TSS_484 TSS_484

Gene      
Name: mhpE    Texpresso search in the literature
Synonym(s): ECK0349, G6205, b0352
Genome position(nucleotides): 373868 --> 374881 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.51
External database links:  
ASAP:
ABE-0001209
ECHOBASE:
EB3077
ECOLIHUB:
mhpE
OU-MICROARRAY:
b0352
STRING:
511145.b0352
COLOMBOS: mhpE


Product      
Name: 4-hydroxy-2-oxovalerate aldolase
Synonym(s): MhpE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.47
Isoelectric point: 6.008
Motif(s):
 
Type Positions Sequence
14 -> 15 RD
6 -> 262 LYISDVTLRDGMHAIRHQYSLENVRQIAKALDDARVDSIEVAHGDGLQGSSFNYGFGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGARVVRVATHCTEADVSAQHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCIYVVDSGGAMNMSDIRDRFRALKAELKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDASLAGMGAGAGNAPLEVFIAAADKLGWQHGTDLYALMDAAD
274 -> 334 RVDRETLALGYAGVYSSFLRHCETAAARYGLSAVDILVELGKRRMVGGQEDMIVDVALDLR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016833 - oxo-acid-lyase activity
GO:0003852 - 2-isopropylmalate synthase activity
GO:0030145 - manganese ion binding
GO:0008701 - 4-hydroxy-2-oxovalerate aldolase activity
biological_process GO:0009098 - leucine biosynthetic process
GO:0019439 - aromatic compound catabolic process
GO:0019380 - 3-phenylpropionate catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10209N
ECOCYC:
MHPELY-MONOMER
ECOLIWIKI:
b0352
INTERPRO:
IPR035685
INTERPRO:
IPR000891
INTERPRO:
IPR012425
INTERPRO:
IPR013785
INTERPRO:
IPR017629
MODBASE:
P51020
PFAM:
PF00682
PFAM:
PF07836
PRIDE:
P51020
PRODB:
PRO_000023232
PROSITE:
PS50991
REFSEQ:
NP_414886
SMR:
P51020
SWISSMODEL:
P51020
UNIPROT:
P51020


Operon      
Name: mhpABCDFE         
Operon arrangement:
Transcription unit        Promoter
mhpABCDFE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, MhpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_484 374977 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB