RegulonDB RegulonDB 10.9: Gene Form
   

yaiI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

proC aroL yaiI TrpR TrpR TyrR TyrR TyrR aroLp2 aroLp2 aroLp aroLp TSS_498 TSS_498 yaiIp3 yaiIp3 yaiIp6 yaiIp6 yaiIp7 yaiIp7 proCp proCp TSS_496 TSS_496

Gene      
Name: yaiI    Texpresso search in the literature
Synonym(s): ECK0382, G6230, b0387
Genome position(nucleotides): 405764 --> 406222 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.43
External database links:  
ASAP:
ABE-0001344
ECHOBASE:
EB2968
ECOLIHUB:
yaiI
OU-MICROARRAY:
b0387
STRING:
511145.b0387
COLOMBOS: yaiI


Product      
Name: DUF188 domain-containing protein YaiI
Synonym(s): YaiI
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 16.969
Isoelectric point: 5.321
Motif(s):
 
Type Positions Sequence
17 -> 143 ILYRAAERMQMPLVLVANQSLRVPPSRFIRTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRERLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6230-MONOMER
ECOLIWIKI:
b0387
INTERPRO:
IPR003791
PANTHER:
PTHR35146
PFAM:
PF02639
PRIDE:
P0A8D3
REFSEQ:
NP_414921
SMR:
P0A8D3
UNIPROT:
P0A8D3


Operon      
Name: yaiI         
Operon arrangement:
Transcription unit        Promoter
yaiI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_496 405666 reverse nd [RS-EPT-CBR] [1]
  promoter yaiIp7 405698 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiIp6 405708 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiIp3 405723 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_498 406276 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB