RegulonDB RegulonDB 10.9: Gene Form
   

thiI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thiI yajL xseB panE TSS_539 TSS_539 thiIp thiIp xseBp xseBp

Gene      
Name: thiI    Texpresso search in the literature
Synonym(s): ECK0417, G6238, b0423, nuvA, yajK
Genome position(nucleotides): 441549 --> 442997 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.17
External database links:  
ASAP:
ABE-0001470
ECHOBASE:
EB3058
ECOLIHUB:
thiI
OU-MICROARRAY:
b0423
STRING:
511145.b0423
COLOMBOS: thiI


Product      
Name: tRNA uridine 4-sulfurtransferase
Synonym(s): 4-thiouridine synthetase, NuvA, ThiI, YajK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 54.973
Isoelectric point: 6.576
Motif(s):
 
Type Positions Sequence
28 -> 161 GNIRNVLKHYDETLAVVRHWDNIEVRAKDENQRLAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLEGKTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLL
108 -> 108 C
321 -> 321 K
183 -> 184 LI
61 -> 165 LAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLEGKTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIKGR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.8 - thiamin
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0003723 - RNA binding
GO:0016783 - sulfurtransferase activity
GO:0000049 - tRNA binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004810 - tRNA adenylyltransferase activity
GO:0097163 - sulfur carrier activity
biological_process GO:0009228 - thiamine biosynthetic process
GO:0034227 - tRNA thio-modification
GO:0009229 - thiamine diphosphate biosynthetic process
GO:0052837 - thiazole biosynthetic process
GO:0002937 - tRNA 4-thiouridine biosynthesis
Note(s): Note(s): ...[more].
Reference(s): [1] Blondel MO., et al., 1988
[2] Caldeira de Araujo A., et al., 1986
[3] Emilsson V., et al., 1992
[4] Harris CL. 1990
[5] Harris CL., et al., 1989
[6] Hoerter J., et al., 1990
[7] Kayne MS., et al., 1979
[8] Kotera M., et al., 2010
[9] Lauhon CT., et al., 2000
[10] Lipsett MN. 1972
[11] Oppezzo OJ., et al., 2003
[12] Ryals J., et al., 1982
[13] Shi R., et al., 2010
[14] Shigi N. 2010
[15] Thomas G., et al., 1977
[16] Thomas G., et al., 1977
[17] Wright CM., et al., 2006
External database links:  
DIP:
DIP-10985N
ECOCYC:
THII-MONOMER
ECOLIWIKI:
b0423
INTERPRO:
IPR004114
INTERPRO:
IPR003720
INTERPRO:
IPR001763
INTERPRO:
IPR014729
INTERPRO:
IPR036873
INTERPRO:
IPR026340
INTERPRO:
IPR020536
MODBASE:
P77718
PFAM:
PF02568
PFAM:
PF02926
PRIDE:
P77718
PRODB:
PRO_000024058
PROSITE:
PS50206
PROSITE:
PS51165
REFSEQ:
NP_414957
SMART:
SM00981
SMR:
P77718
UNIPROT:
P77718


Operon      
Name: thiI         
Operon arrangement:
Transcription unit        Promoter
thiI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_539 441469 forward nd [RS-EPT-CBR] [18]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Blondel MO., Favre A., 1988, tRNAPhe and tRNAPro are the near-ultraviolet molecular targets triggering the growth delay effect., Biochem Biophys Res Commun 150(3):979-86

 [2] Caldeira de Araujo A., Favre A., 1986, Near ultraviolet DNA damage induces the SOS responses in Escherichia coli., EMBO J 5(1):175-9

 [3] Emilsson V., Naslund AK., Kurland CG., 1992, Thiolation of transfer RNA in Escherichia coli varies with growth rate., Nucleic Acids Res 20(17):4499-505

 [4] Harris CL., 1990, High-molecular-weight forms of aminoacyl-tRNA synthetases and tRNA modification enzymes in Escherichia coli., J Bacteriol 172(4):1798-803

 [5] Harris CL., Kolanko CJ., 1989, A rapid diethylaminoethyl paper disk assay for transfer RNA sulfurtransferase., Anal Biochem 176(1):57-62

 [6] Hoerter J., Eisenstark A., 1990, Patterns of protein synthesis in a growth delay mutant (nuv) of Escherichia coli after treatment by near-UV radiation or hydrogen peroxide., J Photochem Photobiol B 6(3):283-9

 [7] Kayne MS., LaBone T., 1979, A rapid assay for Escherichia coli 4-thiouridine-tRNA sulfurtransferase., Anal Biochem 98(1):146-53

 [8] Kotera M., Bayashi T., Hattori M., Tokimatsu T., Goto S., Mihara H., Kanehisa M., 2010, Comprehensive genomic analysis of sulfur-relay pathway genes., Genome Inform 24:104-15

 [9] Lauhon CT., Kambampati R., 2000, The iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD., J Biol Chem 275(26):20096-103

 [10] Lipsett MN., 1972, Biosynthesis of 4-thiouridylate. Participation of a sulfurtransferase containing pyridoxal 5'-phosphate., J Biol Chem 247(5):1458-61

 [11] Oppezzo OJ., Pizarro RA., 2003, Inhibition of sulfur incorporation to transfer RNA by ultraviolet-A radiation in Escherichia coli., J Photochem Photobiol B 71(1-3):69-75

 [12] Ryals J., Hsu RY., Lipsett MN., Bremer H., 1982, Isolation of single-site Escherichia coli mutants deficient in thiamine and 4-thiouridine syntheses: identification of a nuvC mutant., J Bacteriol 151(2):899-904

 [13] Shi R., Proteau A., Villarroya M., Moukadiri I., Zhang L., Trempe JF., Matte A., Armengod ME., Cygler M., 2010, Structural basis for Fe-S cluster assembly and tRNA thiolation mediated by IscS protein-protein interactions., PLoS Biol 8(4):e1000354

 [14] Shigi N., 2010, [Functions and biosynthesis pathway of sulfur-modifications in tRNA]., Seikagaku 82(7):623-8

 [15] Thomas G., Favre A., 1977, [Mutants of Escherichia coli deficient in 4-thiouridine in which growth is insensitive to illumination at 365 nm]., C R Acad Hebd Seances Acad Sci D 284(14):1345-7

 [16] Thomas G., Favre A., 1977, [4-Thiouridine and photoprotection in Escherichia coli K 12]., C R Acad Hebd Seances Acad Sci D 284(24):2569-72

 [17] Wright CM., Christman GD., Snellinger AM., Johnston MV., Mueller EG., 2006, Direct evidence for enzyme persulfide and disulfide intermediates during 4-thiouridine biosynthesis., Chem Commun (Camb) (29):3104-6

 [18] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB