RegulonDB RegulonDB 10.9: Gene Form
   

tfaX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

appY ybcY tfaD tfaX aaaD ArcA TSS_687 TSS_687 appYp2 appYp2 appYp3 appYp3 appYp appYp TSS_686 TSS_686

Gene      
Name: tfaX    Texpresso search in the literature
Synonym(s): ECK0555, G6317, b0563, ylcE
Genome position(nucleotides): 582875 --> 583060 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.46
External database links:  
ASAP:
ABE-0001926
ECHOBASE:
EB4064
ECOLIHUB:
tfaX
OU-MICROARRAY:
b0563
COLOMBOS: tfaX


Product      
Name: DLP12 prophage; protein TfaX
Synonym(s): TfaX, YlcE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.088
Isoelectric point: 3.656
Motif(s):
 
Type Positions Sequence
31 -> 61 YIQEFSEYIAPLQDAVDLEIATEEERSLLEA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6317-MONOMER
ECOLIWIKI:
b0563
INTERPRO:
IPR003458
PFAM:
PF02413
REFSEQ:
NP_415095
UNIPROT:
P77087


Operon      
Name: tfaX         
Operon arrangement:
Transcription unit        Promoter
tfaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_686 582219 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_687 584165 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB