RegulonDB RegulonDB 10.9: Gene Form
   

uspG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ahpF ybdR uspG terminator TSS_747 TSS_747 TSS_746 TSS_746 ybdRp6 ybdRp6 uspGp uspGp TSS_744 TSS_744 TSS_743 (cluster) TSS_743 (cluster) TSS_742 TSS_742

Gene      
Name: uspG    Texpresso search in the literature
Synonym(s): ECK0601, G6334, UP12, b0607, ybdQ, yzzU
Genome position(nucleotides): 641439 <-- 641867 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.88
External database links:  
ASAP:
ABE-0002095
ECHOBASE:
EB2547
ECOLIHUB:
uspG
OU-MICROARRAY:
b0607
STRING:
511145.b0607
COLOMBOS: uspG


Product      
Name: universal stress protein G
Synonym(s): UP12, UspG, YbdQ, YzzU, universal stress protein UP12
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.935
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
1 -> 142 MYKTIIMPVDVFEMELSDKAVRHAEFLAQDDGVIHLLHVLPGSASLSLHRFAADVRRFEEHLQHEAQERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
  5 - cell processes --> 5.5 - adaptations
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0005515 - protein binding
GO:0004017 - adenylate kinase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0046940 - nucleoside monophosphate phosphorylation
GO:0006950 - response to stress
GO:0046777 - protein autophosphorylation
GO:2000145 - regulation of cell motility
GO:0018117 - protein adenylylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11354N
ECOCYC:
G6334-MONOMER
ECOLIWIKI:
b0607
INTERPRO:
IPR014729
INTERPRO:
IPR006015
INTERPRO:
IPR006016
MODBASE:
P39177
PANTHER:
PTHR46268
PFAM:
PF00582
PRIDE:
P39177
PRINTS:
PR01438
PRODB:
PRO_000024196
REFSEQ:
NP_415140
SMR:
P39177
UNIPROT:
P39177


Operon      
Name: uspG         
Operon arrangement:
Transcription unit        Promoter
uspG


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_742 639766 forward nd [RS-EPT-CBR] [1]
  promoter TSS_743 (cluster) 640123 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_744 640189 forward nd [RS-EPT-CBR] [1]
  promoter ybdRp6 641922 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_746 642181 forward nd [RS-EPT-CBR] [1]
  promoter TSS_747 643027 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB