RegulonDB RegulonDB 10.9: Gene Form
   

citC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dpiB citC citD dpiA citE NarL DcuR DpiA DpiA DcuR DpiA FNR CRP NarL ArcA dpiBp2 dpiBp2 citCp2 citCp2 dpiBp dpiBp citCp1 citCp1

Gene      
Name: citC    Texpresso search in the literature
Synonym(s): ECK0611, G6344, b0618, ybeO
Genome position(nucleotides): 650798 <-- 651856 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.9
External database links:  
ASAP:
ABE-0002126
ECHOBASE:
EB3409
ECOLIHUB:
citC
OU-MICROARRAY:
b0618
STRING:
511145.b0618
COLOMBOS: citC


Product      
Name: citrate lyase synthetase
Synonym(s): CitC, YbeO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.077
Isoelectric point: 8.214
Motif(s):
 
Type Positions Sequence
147 -> 333 IGCIVMNANPFTNGHRYLIQQAAAQCDWLHLFLVKEDSSRFPYEDRLDLVLKGTADIPRLTVHRGSEYIISRATFPCYFIKEQSVINHCYTEIDLKIFRQYLAPALGVTHRFVGTEPFCRVTAQYNQDMRYWLETPTISAPPIELVEIERLRYQEMPISASRVRQLLAKNDLTAIAPLVPAVTLHYL
1 -> 128 MFGNDIFTRVKRSENKKMAEIAQFLHENDLSVDTTVEVFITVTRDEKLIACGGIAGNIIKCVAISESVRGEGLALTLATELINLAYERHSTHLFIYTKTEYEALFRQCGFSTLTSVPGVMVLMENSAT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0008080 - N-acetyltransferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008771 - [citrate (pro-3S)-lyase] ligase activity
biological_process GO:0006464 - cellular protein modification process
GO:0009058 - biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
CITC-MONOMER
ECOLIWIKI:
b0618
INTERPRO:
IPR000182
INTERPRO:
IPR016181
INTERPRO:
IPR014729
INTERPRO:
IPR004821
INTERPRO:
IPR005216
INTERPRO:
IPR013166
MODBASE:
P77390
PANTHER:
PTHR40599
PFAM:
PF08218
PRIDE:
P77390
PRODB:
PRO_000022288
PROSITE:
PS51186
REFSEQ:
NP_415151
SMART:
SM00764
UNIPROT:
P77390


Operon      
Name: citCDEFXG         
Operon arrangement:
Transcription unit        Promoter
citCDEFXG
citCDEFXG


Transcriptional Regulation      
Display Regulation             
Activated by: DpiA
Repressed by: CRP, FNR, ArcA, NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB