RegulonDB RegulonDB 10.9: Gene Form
   

djlB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

djlB ybeQ ybeR ybeT ybeQp1 ybeQp1 ybeQp11 ybeQp11 ybeQp8 ybeQp8 ybeRp6 ybeRp6 ybeQp10 ybeQp10 ybeQp12 ybeQp12 ybeRp5 ybeRp5 ybeQp5 ybeQp5 ybeRp7 ybeRp7

Gene      
Name: djlB    Texpresso search in the literature
Synonym(s): ECK0639, G6353, b0646, ybeS
Genome position(nucleotides): 677415 --> 678842 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.48
External database links:  
ASAP:
ABE-0002210
ECHOBASE:
EB3413
ECOLIHUB:
djlB
OU-MICROARRAY:
b0646
STRING:
511145.b0646
COLOMBOS: djlB


Product      
Name: J domain-containing protein DjlB
Synonym(s): DjlB, YbeS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 55.256
Isoelectric point: 4.673
Motif(s):
 
Type Positions Sequence
3 -> 70 NCWKILDIEETTDVDIIRRAYLALLPSFHPETDPQGFKQLRQAYEEALRIAQSPAKSVWQPEEYEVAE
453 -> 474 IIKIIFYIFIFAGLIGKILHLF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005887 - integral component of plasma membrane
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Itoh T., et al., 1999
External database links:  
ECOCYC:
G6353-MONOMER
ECOLIWIKI:
b0646
INTERPRO:
IPR001623
INTERPRO:
IPR036869
PRIDE:
P77381
PROSITE:
PS50076
REFSEQ:
NP_415179
SMART:
SM00271
SMR:
P77381
UNIPROT:
P77381


Operon      
Name: ybeR-djlB         
Operon arrangement:
Transcription unit        Promoter
ybeR-djlB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybeRp7 676560 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp5 676572 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeRp5 676590 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp12 676611 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp10 676624 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeRp6 676637 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp8 676639 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp11 676700 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp1 676706 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Itoh T., Matsuda H., Mori H., 1999, Phylogenetic analysis of the third hsp70 homolog in Escherichia coli; a novel member of the Hsc66 subfamily and its possible co-chaperone., DNA Res 6(5):299-305

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB