RegulonDB RegulonDB 10.9: Gene Form
   

fiu gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fiu ybiX mcbA CRP Fur Fur Fur Fur fiup fiup ybiXp2 ybiXp2

Gene      
Name: fiu    Texpresso search in the literature
Synonym(s): ECK0794, G6414, b0805, ybiL
Genome position(nucleotides): 839249 <-- 841531 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.83
Reference(s): [1] Hantke K. 1983
External database links:  
ASAP:
ABE-0002749
ECHOBASE:
EB3101
ECOLIHUB:
fiu
OU-MICROARRAY:
b0805
STRING:
511145.b0805
COLOMBOS: fiu


Product      
Name: iron catecholate outer membrane transporter Fiu
Synonym(s): Fiu, TonB dependent iron catecholate transporter, YbiL
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 81.96
Isoelectric point: 5.728
Motif(s):
 
Type Positions Sequence
69 -> 168 ADTTRTMTVISEQVIKDQGATNLTDALKNVPGVGAFFAGENGNSTTGDAIYMRGADTSNSIYIDGIRDIGSVSRDTFNTEQVEVIKGPSGTDYGRSAPTG
259 -> 758 HNTPDGGIPTIGLPGYSAPSAGTAALNHSGKVDTHNFYGTDSDYDDSTTDTATMRFEHDINDNTTIRNTTRWSRVKQDYLMTAIMGGASNITQPTSDVNSWTWSRTANTKDVSNKILTNQTNLTSTFYTGSIGHDVSTGVEFTRETQTNYGVNPVTLPAVNIYHPDSSIHPGGLTRNGANANGQTDTFAIYAFDTLQITRDFELNGGIRLDNYHTEYDSATACGGSGRGAITCPTGVAKGSPVTTVDTAKSGNLMNWKAGALYHLTENGNVYINYAVSQQPPGGNNFALAQSGSGNSANRTDFKPQKANTSEIGTKWQVLDKRLLLTAALFRTDIENEVEQNDDGTYSQYGKKRVEGYEISVAGNITPAWQVIGGYTQQKATIKNGKDVAQDGSSSLPYTPEHAFTLWSQYQATDDISVGAGARYIGSMHKGSDGAVGTPAFTEGYWVADAKLGYRVNRNLDFQLNVYNLFDTDYVASINKSGYRYHPGEPRTFLLTANM
743 -> 760 RYHPGEPRTFLLTANMHF
1 -> 31 MENNRNFPARQFHSLTFFAGLCIGITPVAQA
32 -> 760 LAAEGQTNADDTLVVEASTPSLYAPQQSADPKFSRPVADTTRTMTVISEQVIKDQGATNLTDALKNVPGVGAFFAGENGNSTTGDAIYMRGADTSNSIYIDGIRDIGSVSRDTFNTEQVEVIKGPSGTDYGRSAPTGSINMISKQPRNDSGIDASASIGSAWFRRGTLDVNQVIGDTTAVRLNVMGEKTHDAGRDKVKNERYGVAPSVAFGLGTANRLYLNYLHVTQHNTPDGGIPTIGLPGYSAPSAGTAALNHSGKVDTHNFYGTDSDYDDSTTDTATMRFEHDINDNTTIRNTTRWSRVKQDYLMTAIMGGASNITQPTSDVNSWTWSRTANTKDVSNKILTNQTNLTSTFYTGSIGHDVSTGVEFTRETQTNYGVNPVTLPAVNIYHPDSSIHPGGLTRNGANANGQTDTFAIYAFDTLQITRDFELNGGIRLDNYHTEYDSATACGGSGRGAITCPTGVAKGSPVTTVDTAKSGNLMNWKAGALYHLTENGNVYINYAVSQQPPGGNNFALAQSGSGNSANRTDFKPQKANTSEIGTKWQVLDKRLLLTAALFRTDIENEVEQNDDGTYSQYGKKRVEGYEISVAGNITPAWQVIGGYTQQKATIKNGKDVAQDGSSSLPYTPEHAFTLWSQYQATDDISVGAGARYIGSMHKGSDGAVGTPAFTEGYWVADAKLGYRVNRNLDFQLNVYNLFDTDYVASINKSGYRYHPGEPRTFLLTANMHF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0045203 - integral component of cell outer membrane
molecular_function GO:0038023 - signaling receptor activity
GO:0015344 - siderophore uptake transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0055072 - iron ion homeostasis
GO:0015891 - siderophore transport
GO:0042884 - microcin transport
GO:0033214 - siderophore-dependent iron import into cell
GO:0044718 - siderophore transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [2] Critchley IA., et al., 1991
[3] Hantke K. 1987
[4] Mercado G., et al., 2008
[5] Mollmann U., et al., 1998
[6] Muela A., et al., 2008
[7] Muller SI., et al., 2009
[8] Reissbrodt R., et al., 1997
External database links:  
DIP:
DIP-11432N
ECOCYC:
G6414-MONOMER
ECOLIWIKI:
b0805
INTERPRO:
IPR037066
INTERPRO:
IPR039423
INTERPRO:
IPR036942
INTERPRO:
IPR030148
INTERPRO:
IPR012910
INTERPRO:
IPR010916
INTERPRO:
IPR010105
INTERPRO:
IPR000531
MODBASE:
P75780
PANTHER:
PTHR32552
PANTHER:
PTHR32552:SF80
PDB:
6BPM
PDB:
6BPN
PDB:
6BPO
PFAM:
PF07715
PFAM:
PF00593
PRIDE:
P75780
PRODB:
PRO_000022627
PROSITE:
PS00430
REFSEQ:
NP_415326
SMR:
P75780
UNIPROT:
P75780


Operon      
Name: fiu         
Operon arrangement:
Transcription unit        Promoter
fiu


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybiXp2 839274 reverse Similarity to the consensus
Read more >
[ICWHO] [9]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hantke K., 1983, Identification of an iron uptake system specific for coprogen and rhodotorulic acid in Escherichia coli K12., Mol Gen Genet 191(2):301-6

 [2] Critchley IA., Basker MJ., Edmondson RA., Knott SJ., 1991, Uptake of a catecholic cephalosporin by the iron transport system of Escherichia coli., J Antimicrob Chemother 28(3):377-88

 [3] Hantke K., 1987, Selection procedure for deregulated iron transport mutants (fur) in Escherichia coli K 12: fur not only affects iron metabolism., Mol Gen Genet 210(1):135-9

 [4] Mercado G., Tello M., Marin M., Monasterio O., Lagos R., 2008, The production in vivo of microcin E492 with antibacterial activity depends on salmochelin and EntF., J Bacteriol 190(15):5464-71

 [5] Mollmann U., Ghosh A., Dolence EK., Dolence JA., Ghosh M., Miller MJ., Reissbrodt R., 1998, Selective growth promotion and growth inhibition of gram-negative and gram-positive bacteria by synthetic siderophore-beta-lactam conjugates., Biometals 11(1):1-12

 [6] Muela A., Seco C., Camafeita E., Arana I., Orruno M., Lopez JA., Barcina I., 2008, Changes in Escherichia coli outer membrane subproteome under environmental conditions inducing the viable but nonculturable state., FEMS Microbiol Ecol 64(1):28-36

 [7] Muller SI., Valdebenito M., Hantke K., 2009, Salmochelin, the long-overlooked catecholate siderophore of Salmonella., Biometals 22(4):691-5

 [8] Reissbrodt R., Ramiandrasoa F., Bricard L., Kunesch G., 1997, Siderophore activity of chemically synthesized dihydroxybenzoyl derivatives of spermidines and cystamide., Biometals 10(2):95-103

 [9] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB