RegulonDB RegulonDB 10.8: Gene Form
   

gsiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gsiA gsiB moeA iaaA NarL ArcA NarL FNR anti-anti-terminator anti-terminator terminator iaaAp iaaAp moeAp moeAp

Gene      
Name: gsiA    Texpresso search in the literature
Synonym(s): ECK0819, G6429, b0829, yliA
Genome position(nucleotides): 867520 --> 869391 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.01
External database links:  
ASAP:
ABE-0002830
ECHOBASE:
EB3245
OU-MICROARRAY:
b0829
PortEco:
gsiA
STRING:
511145.b0829
COLOMBOS: gsiA


Product      
Name: glutathione ABC transporter ATP binding subunit GsiA
Synonym(s): GsiA, YliA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 69.114
Isoelectric point: 7.527
Motif(s):
 
Type Positions Sequence
15 -> 269 VENLNIAFMQDQQKIAAVRNLSFSLQRGETLAIVGESGSGKSVTALALMRLLEQAGGLVQCDKMLLQRRSREVIELSEQNAAQMRHVRGADMAMIFQEPMTSLNPVFTVGEQIAESIRLHQNASREEAMVEAKRMLDQVRIPEAQTILSRYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIKVLQKEMSMGVIFITHDMGVVAEIADRVLVMYQGEAVETGTVEQIFHAPQHPYTRALL
248 -> 280 VETGTVEQIFHAPQHPYTRALLAAVPQLGAMKG
357 -> 364 GESGSGKS
314 -> 564 LRVRNLVTRFPLRSGLLNRVTREVHAVEKVSFDLWPGETLSLVGESGSGKSTTGRALLRLVESQGGEIIFNGQRIDTLSPGKLQALRRDIQFIFQDPYASLDPRQTIGDSIIEPLRVHGLLPGKDAAARVAWLLERVGLLPEHAWRYPHEFSGGQRQRICIARALALNPKVIIADEAVSALDVSIRGQIINLLLDLQRDFGIAYLFISHDMAVVERISHRVAVMYLGQIVEIGPRRAVFENPQHPYTRKLL
543 -> 575 VEIGPRRAVFENPQHPYTRKLLAAVPVAEPSRQ

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0034634 - glutathione transmembrane transporter activity
biological_process GO:0015833 - peptide transport
GO:0055085 - transmembrane transport
GO:0034775 - glutathione transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
[2] Wang Z., et al., 2011
External database links:  
ECOCYC:
YLIA-MONOMER
ECOLIWIKI:
b0829
INTERPRO:
IPR013563
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P75796
PFAM:
PF00005
PFAM:
PF08352
PRIDE:
P75796
PRODB:
PRO_000022844
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_415350
SMART:
SM00382
SMR:
P75796
UNIPROT:
P75796


Operon      
Name: iaaA-gsiABCD         
Operon arrangement:
Transcription unit        Promoter
iaaA-gsiABCD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Wang Z., Xiang Q., Wang G., Wang H., Zhang Y., 2011, Optimizing expression and purification of an ATP-binding gene gsiA from Escherichia coli k-12 by using GFP fusion., Genet Mol Biol 34(4):661-8


RegulonDB