RegulonDB RegulonDB 10.9: Gene Form
   

ybjI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybjJ ybjI rcdA ybjH terminator

Gene      
Name: ybjI    Texpresso search in the literature
Synonym(s): ECK0834, G6442, b0844
Genome position(nucleotides): 885316 <-- 886131 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.59
External database links:  
ASAP:
ABE-0002877
ECHOBASE:
EB3442
ECOLIHUB:
ybjI
OU-MICROARRAY:
b0844
STRING:
511145.b0844
COLOMBOS: ybjI


Product      
Name: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
Synonym(s): YbjI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.196
Isoelectric point: 4.596
Motif(s):
 
Type Positions Sequence
6 -> 259 IAVDMDGTFLSDQKTYNRERFMAQYQQMKAQGIRFVVASGNQYYQLISFFPEIANEIAFVAENGGWVVSEGKDVFNGELSKDAFATVVEHLLTRPEVEIIACGKNSAYTLKKYDDAMKTVAEMYYHRLEYVDNFDNLEDIFFKFGLNLSDELIPQVQKALHEAIGDIMVSVHTGNGSIDLIIPGVHKANGLRQLQKLWGIDDSEVVVFGDGGNDIEMLRQAGFSFAMENAGSAVVAAAKYRAGSNNREGVLDVI
44 -> 45 SG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.9 - riboflavin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016791 - phosphatase activity
GO:0000287 - magnesium ion binding
GO:0043726 - 5-amino-6-(5-phosphoribitylamino)uracil phosphatase activity
biological_process GO:0009231 - riboflavin biosynthetic process
GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Kuznetsova E., et al., 2005
External database links:  
ECOCYC:
G6442-MONOMER
ECOLIWIKI:
b0844
INTERPRO:
IPR036412
INTERPRO:
IPR023214
INTERPRO:
IPR006379
INTERPRO:
IPR000150
MODBASE:
P75809
PFAM:
PF08282
PRIDE:
P75809
PROSITE:
PS01229
REFSEQ:
NP_415365
SMR:
P75809
SWISSMODEL:
P75809
UNIPROT:
P75809


Operon      
Name: ybjJI         
Operon arrangement:
Transcription unit        Promoter
ybjJI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Kuznetsova E., Proudfoot M., Sanders SA., Reinking J., Savchenko A., Arrowsmith CH., Edwards AM., Yakunin AF., 2005, Enzyme genomics: Application of general enzymatic screens to discover new enzymes., FEMS Microbiol Rev 29(2):263-79


RegulonDB