RegulonDB RegulonDB 10.9: Gene Form
   

ybjJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybjJ ybjI rcdA ybjH terminator

Gene      
Name: ybjJ    Texpresso search in the literature
Synonym(s): ECK0835, G6443, b0845
Genome position(nucleotides): 886131 <-- 887339 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.92
External database links:  
ASAP:
ABE-0002880
ECHOBASE:
EB3443
ECOLIHUB:
ybjJ
OU-MICROARRAY:
b0845
STRING:
511145.b0845
COLOMBOS: ybjJ


Product      
Name: inner membrane protein YbjJ
Synonym(s): YbjJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 41.852
Isoelectric point: 9.019
Motif(s):
 
Type Positions Sequence
49 -> 71 MGGVLFGLSIGSMSGILCSAWLV
78 -> 100 NVILVTMSCALIGMMILSLALWL
165 -> 187 GVPATVHILLAALVGIAPIYIAI
223 -> 388 VVLAMAFAEGSANDWLPLLMVDGHGFSPTSGSLIYAGFTLGMTVGRFTGGWFIDRYSRVAVVRASALMGALGIGLIIFVDSAWVAGVSVVLWGLGASLGFPLTISAASDTGPDAPTRVSVVATTGYLAFLVGPPLLGYLGEHYGLRSAMLVVLALVILAAIVAKAV
253 -> 275 GSLIYAGFTLGMTVGRFTGGWFI

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
G6443-MONOMER
ECOLIWIKI:
b0845
INTERPRO:
IPR011701
INTERPRO:
IPR020846
INTERPRO:
IPR036259
MODBASE:
P75810
PFAM:
PF07690
PRIDE:
P75810
PROSITE:
PS50850
REFSEQ:
NP_415366
UNIPROT:
P75810


Operon      
Name: ybjJI         
Operon arrangement:
Transcription unit        Promoter
ybjJI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB