RegulonDB RegulonDB 10.9: Gene Form
   

insF4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcT insEF4 insF4 insE4 insFp4 insFp4 insFp5 insFp5

Gene      
Name: insF4    Texpresso search in the literature
Synonym(s): ECK0299, G6533, b1026, tra5-3
Genome position(nucleotides): 1094275 <-- 1095141 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.13
External database links:  
ASAP:
ABE-0003475
ECOLIHUB:
insF-4
ECOO157CYC:
Z1573
OU-MICROARRAY:
b0372
COLOMBOS: insF4


Product      
Name: IS3 element protein InsF
Synonym(s): InsF4
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 33.54
Isoelectric point: 10.145
Motif(s):
 
Type Positions Sequence
231 -> 287 ESFFHSLKVECIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQFENKNL
124 -> 287 YASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACVESFFHSLKVECIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQFENKNL
52 -> 101 VVLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRK
127 -> 224 GPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCC

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0006310 - DNA recombination
GO:0032196 - transposition
GO:0015074 - DNA integration
External database links:  
ECOCYC:
MONOMER0-4443
INTERPRO:
IPR001584
INTERPRO:
IPR012337
INTERPRO:
IPR025948
INTERPRO:
IPR036397
PFAM:
PF13333
PFAM:
PF13276
PFAM:
PF00665
PRIDE:
P0CF82
PROSITE:
PS50994
REFSEQ:
NP_415545
UNIPROT:
P0CF82


Operon      
Name: insEF4E4F4         
Operon arrangement:
Transcription unit        Promoter
insE4F4EF4


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insFp5 1095155 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter insFp4 1095196 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycdUp9 1095633 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycdUp1 1095693 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycdUp11 1095759 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB