RegulonDB RegulonDB 10.9: Gene Form
   

cobB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nagK cobB ycfZ ymfA TSS_1455 TSS_1455

Gene      
Name: cobB    Texpresso search in the literature
Synonym(s): ECK1106, G6577, b1120, ycfY
Genome position(nucleotides): 1179520 --> 1180359 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.79
External database links:  
ASAP:
ABE-0003781
ECHOBASE:
EB3217
ECOLIHUB:
cobB
OU-MICROARRAY:
b1120
STRING:
511145.b1120
COLOMBOS: cobB


Product      
Name: protein-lysine deacetylase/desuccinylase/lipoamidase
Synonym(s): CobB, CobB-L, YcfY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.464
Isoelectric point: 8.053
Motif(s):
 
Type Positions Sequence
1 -> 37 MLSRRGHRLSRFRKNKRRLRERLRQRIFFRDKVVPEA
48 -> 221 GAGISAESGIRTFRAADGLWEEHRVEDVATPEGFDRDPELVQAFYNARRRQLQQPEIQPNAAHLALAKLQDALGDRFLLVTQNIDNLHERAGNTNVIHMHGELLKVRCSQSGQVLDWTGDVTPEDKCHCCQFPAPLRPHVVWFGEMPLGMDEIYMALSMADIFIAIGTSGHVYP
58 -> 58 R
92 -> 92 Y
95 -> 95 R

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003950 - NAD+ ADP-ribosyltransferase activity
GO:0061690 - lipoamidase activity
GO:0061697 - protein-glutaryllysine deglutarylase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0042803 - protein homodimerization activity
GO:0034979 - NAD-dependent protein deacetylase activity
GO:0070403 - NAD+ binding
GO:0035438 - cyclic-di-GMP binding
GO:0036054 - protein-malonyllysine demalonylase activity
GO:0036055 - protein-succinyllysine desuccinylase activity
biological_process GO:0061698 - protein deglutarylation
GO:0061699 - peptidyl-lysine deglutarylation
GO:0006935 - chemotaxis
GO:0006476 - protein deacetylation
GO:0051607 - defense response to virus
GO:0036047 - peptidyl-lysine demalonylation
GO:0036048 - protein desuccinylation
GO:0036049 - peptidyl-lysine desuccinylation
GO:0034983 - peptidyl-lysine deacetylation
External database links:  
DIP:
DIP-9301N
ECOCYC:
G6577-MONOMER
ECOLIWIKI:
b1120
INTERPRO:
IPR027546
INTERPRO:
IPR026591
INTERPRO:
IPR029035
INTERPRO:
IPR003000
INTERPRO:
IPR026590
MINT:
MINT-1290133
MODBASE:
P75960
PANTHER:
PTHR11085
PDB:
1S5P
PFAM:
PF02146
PRIDE:
P75960
PRODB:
PRO_000023401
PROSITE:
PS50305
REFSEQ:
NP_415638
SMR:
P75960
UNIPROT:
P75960-1


Operon      
Name: nagK-cobB         
Operon arrangement:
Transcription unit        Promoter
nagK-cobB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1455 1179908 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB