RegulonDB RegulonDB 10.9: Gene Form
   

rluE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

icd rluE nudJ ArcA ArcA Cra anti-anti-terminator anti-terminator terminator TSS_1490 TSS_1490 TSS_1489 TSS_1489 TSS_1488 TSS_1488 TSS_1487 TSS_1487 TSS_1486 (cluster) TSS_1486 (cluster) TSS_1485 TSS_1485 TSS_1484 TSS_1484 TSS_1483 (cluster) TSS_1483 (cluster) TSS_1482 TSS_1482 icdAp1 icdAp1 TSS_1480 TSS_1480 icdAp2 icdAp2 TSS_1479 (cluster) TSS_1479 (cluster) nudJp6 nudJp6

Gene      
Name: rluE    Texpresso search in the literature
Synonym(s): ECK1121, G6581, b1135, ymfC
Genome position(nucleotides): 1194298 <-- 1194951 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.22
External database links:  
ASAP:
ABE-0003820
ECHOBASE:
EB3221
ECOLIHUB:
rluE
OU-MICROARRAY:
b1135
STRING:
511145.b1135
COLOMBOS: rluE


Product      
Name: 23S rRNA pseudouridine2457 synthase
Synonym(s): RluE, YmfC, ribosomal large subunit pseudouridine synthase E
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.88
Isoelectric point: 10.555
Motif(s):
 
Type Positions Sequence
41 -> 186 VILFNKPYDVLPQFTDEAGRKTLKEFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGIPTQDALEALRNGVTLNDGPTLPAGAELVDEPAWLWPRNPPIRERKSIPTSWLKITLYEGRNRQVRRMTAH
79 -> 79 D

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0120159 - rRNA pseudouridine synthase activity
GO:0016853 - isomerase activity
GO:0016866 - intramolecular transferase activity
GO:0003723 - RNA binding
GO:0009982 - pseudouridine synthase activity
biological_process GO:0009451 - RNA modification
GO:0001522 - pseudouridine synthesis
GO:0006364 - rRNA processing
GO:0000455 - enzyme-directed rRNA pseudouridine synthesis
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12716N
ECOCYC:
G6581-MONOMER
ECOLIWIKI:
b1135
INTERPRO:
IPR020103
INTERPRO:
IPR000748
INTERPRO:
IPR006145
INTERPRO:
IPR018496
INTERPRO:
IPR042092
MODBASE:
P75966
PDB:
2OML
PDB:
2OLW
PFAM:
PF00849
PRIDE:
P75966
PRODB:
PRO_000023780
PROSITE:
PS01149
REFSEQ:
NP_415653
SMR:
P75966
UNIPROT:
P75966


Operon      
Name: rluE-nudJ         
Operon arrangement:
Transcription unit        Promoter
rluE-nudJ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter nudJp6 1194437 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1479 (cluster) 1194944 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1480 1194970 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1482 1195013 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1483 (cluster) 1195019 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1484 1195022 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1485 1195033 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1486 (cluster) 1195396 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1487 1195466 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1488 1195945 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1489 1196007 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1490 1196016 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB