RegulonDB RegulonDB 10.9: Gene Form
   

bluR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bluF bluR ycgX bluRp bluRp ycgXp4 ycgXp4 TSS_1498 TSS_1498 ycgXp5 ycgXp5

Gene      
Name: bluR    Texpresso search in the literature
Synonym(s): ECK1149, G6602, b1162, ycgE
Genome position(nucleotides): 1213328 <-- 1214059 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.77
External database links:  
ASAP:
ABE-0003900
ECHOBASE:
EB3645
ECOLIHUB:
ycgE
OU-MICROARRAY:
b1162
STRING:
511145.b1162
COLOMBOS: bluR


Product      
Name: DNA-binding transcriptional repressor BluR
Synonym(s): BluR, YcgE
Sequence: Get amino acid sequence Fasta Format
Regulator Family: MerR
Cellular location: cytosol
Molecular weight: 28.264
Isoelectric point: 8.448
Motif(s):
 
Type Positions Sequence
4 -> 71 YSIGDVAERCGINPVTLRAWQRRYGLLKPQRSEGGHRLFDEEDIQRIEEIKRWISNGVPVGKVKALLE
3 -> 72 YYSIGDVAERCGINPVTLRAWQRRYGLLKPQRSEGGHRLFDEEDIQRIEEIKRWISNGVPVGKVKALLET
6 -> 25 IGDVAERCGINPVTLRAWQR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
Reference(s): [1] Perez-Rueda E., et al., 2004
[2] Tschowri N., et al., 2009
External database links:  
DIP:
DIP-11552N
ECOCYC:
G6602-MONOMER
ECOLIWIKI:
b1162
INTERPRO:
IPR009061
INTERPRO:
IPR000551
MODBASE:
P75989
PFAM:
PF13411
PRIDE:
P75989
PROSITE:
PS50937
PROSITE:
PS00552
REFSEQ:
NP_415680
SMART:
SM00422
SMR:
P75989
UNIPROT:
P75989


Operon      
Name: bluR         
Operon arrangement:
Transcription unit        Promoter
bluR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycgXp5 1213212 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_1498 1213280 reverse nd [RS-EPT-CBR] [4]
  promoter ycgXp4 1213284 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [2] Tschowri N., Busse S., Hengge R., 2009, The BLUF-EAL protein YcgF acts as a direct anti-repressor in a blue-light response of Escherichia coli., Genes Dev 23(4):522-34

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB