RegulonDB RegulonDB 10.9: Gene Form
   

ymgD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycgH ymgG ymgD ymgF terminator

Gene      
Name: ymgD    Texpresso search in the literature
Synonym(s): ECK1158, G6611, b1171
Genome position(nucleotides): 1222305 <-- 1222634 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.15
External database links:  
ASAP:
ABE-0003926
ECHOBASE:
EB4040
ECOLIHUB:
ymgD
OU-MICROARRAY:
b1171
STRING:
511145.b1171
COLOMBOS: ymgD


Product      
Name: PF16456 family protein YmgD
Synonym(s): YmgD
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 11.852
Isoelectric point: 5.105
Motif(s):
 
Type Positions Sequence
20 -> 109 QDYNIKNGLPSETYITCAEANEMAKTDSAQVAEIVAVMGNASVASRDLKIEQSPELSAKVVEKLNQVCAKDPQMLLITAIDDTMRAIGKK
26 -> 107 NGLPSETYITCAEANEMAKTDSAQVAEIVAVMGNASVASRDLKIEQSPELSAKVVEKLNQVCAKDPQMLLITAIDDTMRAIG
1 -> 19 MKKFALLAGLFVFAPMTWA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48276N
ECOCYC:
G6611-MONOMER
ECOLIWIKI:
b1171
INTERPRO:
IPR038304
INTERPRO:
IPR032497
PDB:
2LRM
PDB:
2LRV
PFAM:
PF16456
PRIDE:
P0AB46
REFSEQ:
NP_415689
SMR:
P0AB46
UNIPROT:
P0AB46


Operon      
Name: ymgGD         
Operon arrangement:
Transcription unit        Promoter
ymgGD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB