RegulonDB RegulonDB 10.9: Gene Form
   

abgR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

abgA abgR mcaS terminator mcaSp mcaSp

Gene      
Name: abgR    Texpresso search in the literature
Synonym(s): ECK1335, G6671, b1339
Genome position(nucleotides): 1404741 --> 1405649 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.61
External database links:  
ASAP:
ABE-0004496
ECHOBASE:
EB3136
ECOLIHUB:
abgR
OU-MICROARRAY:
b1339
STRING:
511145.b1339
COLOMBOS: abgR


Product      
Name: putative LysR-type DNA-binding transcriptional regulator AbgR
Synonym(s): AbgR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.058
Isoelectric point: 7.922
Motif(s):
 
Type Positions Sequence
22 -> 41 IRGASRMLNMSQPALSKSIQ
5 -> 62 VKIHQIRAFVEVARQGSIRGASRMLNMSQPALSKSIQELEEGLAAQLFFRRSKGVTLT
7 -> 66 IHQIRAFVEVARQGSIRGASRMLNMSQPALSKSIQELEEGLAAQLFFRRSKGVTLTDAGE
91 -> 297 GQLAGQINIGMGASISRSLMPAVISRFHQQHPQVKVRIMEGQLVSMINELRQGELDFTINTYYQGPYDHEFTFEKLLEKQFAIFCRPGHPAIGARSIKQLLDYSWTMPTPHGSYYKQLSELLDDQAQTPQVGVVCETFSACISLVAKSDFLSKLPEEMGCDPLHGQGLVMLPVSEILPKAAYYLIQRRDSRQTPLTASLITQFRREC

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Hussein MJ., et al., 1998
External database links:  
ECOCYC:
G6671-MONOMER
ECOLIWIKI:
b1339
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR000847
INTERPRO:
IPR005119
MODBASE:
P77744
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P77744
PRINTS:
PR00039
PRODB:
PRO_000022029
PROSITE:
PS50931
REFSEQ:
NP_415855
SMR:
P77744
UNIPROT:
P77744


Operon      
Name: abgR         
Operon arrangement:
Transcription unit        Promoter
abgR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Hussein MJ., Green JM., Nichols BP., 1998, Characterization of mutations that allow p-aminobenzoyl-glutamate utilization by Escherichia coli., J Bacteriol 180(23):6260-8


RegulonDB