RegulonDB RegulonDB 10.9: Gene Form
   

ynaK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

trkG ydaY b1364 ynaK unknown terminator ynaKp4 ynaKp4 ynaKp8 ynaKp8 ynaKp6 ynaKp6 ynaKp10 ynaKp10

Gene      
Name: ynaK    Texpresso search in the literature
Synonym(s): ECK1363, G6688, b1365
Genome position(nucleotides): 1425377 --> 1425640 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.11
External database links:  
ASAP:
ABE-0004571
ECHOBASE:
EB4044
ECOLIHUB:
ynaK
OU-MICROARRAY:
b1365
STRING:
511145.b1365
COLOMBOS: ynaK


Product      
Name: Rac prophage; ParB-like nuclease domain-containing protein YnaK
Synonym(s): YnaK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.787
Isoelectric point: 6.81
Motif(s):
 
Type Positions Sequence
11 -> 84 PLQELSPYAHNARTHSTEQVAQLVESIKQFGWTNPVLIDEKGEIIAGHGRVMAAEMLKMDSVPVIVLSGLTDEQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6688-MONOMER
ECOLIWIKI:
b1365
INTERPRO:
IPR036086
INTERPRO:
IPR003115
PFAM:
PF02195
PRIDE:
P76068
REFSEQ:
NP_415883
SMART:
SM00470
SMR:
P76068
UNIPROT:
P76068


Operon      
Name: ynaK-ydaY         
Operon arrangement:
Transcription unit        Promoter
ynaK-ydaY


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ynaKp10 1425219 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ynaKp6 1425249 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ynaKp8 1425264 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ynaKp4 1425313 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  translational_attenuator terminator 1426408 1426431 forward nd [ICA] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [ICA] Inferred by computational analysis



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Merino E, Yanofsky C., 2005, Transcription attenuation: a highly conserved regulatory strategy used by bacteria., Trends Genet. 2005 May;21(5):260-4.


RegulonDB