RegulonDB RegulonDB 10.9: Gene Form
   

pinR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pinR tfaR ynaE pinRp1 pinRp1

Gene      
Name: pinR    Texpresso search in the literature
Synonym(s): ECK1369, G6697, b1374, ynaD
Genome position(nucleotides): 1433084 <-- 1433674 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.67
External database links:  
ASAP:
ABE-0004599
ECHOBASE:
EB3154
ECOLIHUB:
pinR
ECOO157CYC:
Z3622
OU-MICROARRAY:
b1374
STRING:
511145.b1374
COLOMBOS: pinR


Product      
Name: Rac prophage; putative site-specific recombinase
Synonym(s): PinR, YnaD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.908
Isoelectric point: 10.526
Motif(s):
 
Type Positions Sequence
3 -> 143 RIFAYCRISTLDQTTENQRREIESAGFKIKPQQIIEEHISGSAATSERPGFNRLLARLKCGDQLIVTKLDRLGCNAMDIRKTVEQLTETGIRVHCLALGGIDLTSPTGKMMMQVISAVAEFERDLLLERTHSGIVRARGAG
147 -> 190 GRPPVLNEEQKQVVFERIKSGVSISAIAREFKTSRQTILRAKAK
5 -> 144 FAYCRISTLDQTTENQRREIESAGFKIKPQQIIEEHISGSAATSERPGFNRLLARLKCGDQLIVTKLDRLGCNAMDIRKTVEQLTETGIRVHCLALGGIDLTSPTGKMMMQVISAVAEFERDLLLERTHSGIVRARGAGK

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016874 - ligase activity
GO:0000150 - recombinase activity
biological_process GO:0006310 - DNA recombination
GO:0015074 - DNA integration
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47969N
ECOCYC:
G6697-MONOMER
ECOLIWIKI:
b1374
ECOO157CYC:
Z3622-MONOMER
INTERPRO:
IPR006120
INTERPRO:
IPR036162
INTERPRO:
IPR009057
INTERPRO:
IPR006119
INTERPRO:
IPR006118
MODBASE:
P0ADI0
PFAM:
PF02796
PFAM:
PF00239
PRIDE:
P0ADI0
PROSITE:
PS00398
PROSITE:
PS51736
REFSEQ:
NP_415892
SMART:
SM00857
SMR:
P0ADI0
UNIPROT:
P0ADI0


Operon      
Name: pinR         
Operon arrangement:
Transcription unit        Promoter
pinR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pinRp1 1433712 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB