RegulonDB RegulonDB 10.9: Gene Form
   

ompN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ompN uspF micC micCp micCp ompNp3 ompNp3 ompNp6 ompNp6 ompNp ompNp ompNp4 ompNp4 uspFp uspFp

Gene      
Name: ompN    Texpresso search in the literature
Synonym(s): ECK1372, G6700, b1377, ynaG
Genome position(nucleotides): 1435760 <-- 1436893 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.65
External database links:  
ASAP:
ABE-0004608
ECHOBASE:
EB3157
ECOLIHUB:
ompN
OU-MICROARRAY:
b1377
STRING:
511145.b1377
COLOMBOS: ompN


Product      
Name: outer membrane porin N
Synonym(s): OmpN, YnaG
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 41.22
Isoelectric point: 4.266
Motif(s):
 
Type Positions Sequence
22 -> 377 AEVYNKDGNKLDLYGKVDGLHYFSDNSAKDGDQSYARLGFKGETQINDQLTGYGQWEYNIQANNTESSKNQSWTRLAFAGLKFADYGSFDYGRNYGVMYDIEGWTDMLPEFGGDSYTNADNFMTGRANGVATYRNTDFFGLVNGLNFAVQYQGNNEGASNGQEGTNNGRDVRHENGDGWGLSTTYDLGMGFSAGAAYTSSDRTNDQVNHTAAGGDKADAWTAGLKYDANNIYLATMYSETRNMTPFGDSDYAVANKTQNFEVTAQYQFDFGLRPAVSFLMSKGRDLHAAGGADNPAGVDDKDLVKYADIGATYYFNKNMSTYVDYKINLLDEDDSFYAANGISTDDIVALGLVYQF
1 -> 21 MKSKVLALLIPALLAAGAAHA
27 -> 377 KDGNKLDLYGKVDGLHYFSDNSAKDGDQSYARLGFKGETQINDQLTGYGQWEYNIQANNTESSKNQSWTRLAFAGLKFADYGSFDYGRNYGVMYDIEGWTDMLPEFGGDSYTNADNFMTGRANGVATYRNTDFFGLVNGLNFAVQYQGNNEGASNGQEGTNNGRDVRHENGDGWGLSTTYDLGMGFSAGAAYTSSDRTNDQVNHTAAGGDKADAWTAGLKYDANNIYLATMYSETRNMTPFGDSDYAVANKTQNFEVTAQYQFDFGLRPAVSFLMSKGRDLHAAGGADNPAGVDDKDLVKYADIGATYYFNKNMSTYVDYKINLLDEDDSFYAANGISTDDIVALGLVYQF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0046930 - pore complex
molecular_function GO:0015288 - porin activity
biological_process GO:0006811 - ion transport
GO:0034220 - ion transmembrane transport
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10400N
ECOCYC:
G6700-MONOMER
ECOLIWIKI:
b1377
INTERPRO:
IPR033900
INTERPRO:
IPR023614
INTERPRO:
IPR001702
INTERPRO:
IPR001897
MODBASE:
P77747
PFAM:
PF00267
PRIDE:
P77747
PRINTS:
PR00182
PRINTS:
PR00183
PRODB:
PRO_000023455
REFSEQ:
NP_415895
SMR:
P77747
UNIPROT:
P77747


Operon      
Name: ydbK-ompN         
Operon arrangement:
Transcription unit        Promoter
ompN
ydbK
ydbK-ompN
ydbK-ompN


Transcriptional Regulation      
Display Regulation             
Activated by: SoxS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ompNp4 1436984 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ompNp6 1437058 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ompNp3 1437079 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB