RegulonDB RegulonDB 10.9: Gene Form
   

hslJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydbK ldhA hslJ ydbJ CysB SoxS SoxS anti-anti-terminator anti-terminator terminator hslJp hslJp ydbJp ydbJp TSS_1788 (cluster) TSS_1788 (cluster) ydbJp1 ydbJp1 ydbKp4 ydbKp4 TSS_1787 TSS_1787 ydbKp ydbKp TSS_1786 TSS_1786 TSS_1785 TSS_1785 TSS_1784 TSS_1784

Gene      
Name: hslJ    Texpresso search in the literature
Synonym(s): ECK1376, G6702, b1379, ydbI
Genome position(nucleotides): 1441321 <-- 1441743 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.81
External database links:  
ASAP:
ABE-0004616
ECHOBASE:
EB2973
ECOLIHUB:
hslJ
OU-MICROARRAY:
b1379
STRING:
511145.b1379
COLOMBOS: hslJ


Product      
Name: lipoprotein implicated in Novobiocin resistance
Synonym(s): HslJ, YdbI
Sequence: Get amino acid sequence Fasta Format
Cellular location: membrane
Molecular weight: 15.166
Isoelectric point: 7.351
Motif(s):
 
Type Positions Sequence
28 -> 131 EQLQHHRFVLESVNGKPVTSDKNPPEISFGEKMMISGSMCNRFSGEGKLSNGELTAKGLAMTRMMCANPQLNELDNTISEMLKEGAQVDLTANQLTLATAKQTL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
biological_process GO:0009408 - response to heat
Note(s): Note(s): ...[more].
Reference(s): [1] Gonnet P., et al., 2004
[2] Han MJ., et al., 2012
External database links:  
DIP:
DIP-9946N
ECOCYC:
G6702-MONOMER
ECOLIWIKI:
b1379
INTERPRO:
IPR038670
INTERPRO:
IPR005184
PDB:
2KTS
PFAM:
PF03724
PRIDE:
P52644
PRODB:
PRO_000022931
REFSEQ:
NP_415897
SMR:
P52644
UNIPROT:
P52644


Operon      
Name: hslJ         
Operon arrangement:
Transcription unit        Promoter
hslJ


Transcriptional Regulation      
Display Regulation             
Repressed by: CysB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1784 1438596 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1785 1438744 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1786 1438759 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1787 1440845 reverse nd [RS-EPT-CBR] [3]
  promoter ydbJp1 1440856 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_1788 (cluster) 1441022 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Gonnet P., Rudd KE., Lisacek F., 2004, Fine-tuning the prediction of sequences cleaved by signal peptidase II: a curated set of proven and predicted lipoproteins of Escherichia coli K-12., Proteomics 4(6):1597-613

 [2] Han MJ., Lee SY., Hong SH., 2012, Comparative analysis of envelope proteomes in Escherichia coli B and K-12 strains., J Microbiol Biotechnol 22(4):470-8

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB