RegulonDB RegulonDB 10.9: Gene Form
   

ydbH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydbH ldhA ydbL ynbE TSS_1789 TSS_1789 ldhAp ldhAp ydbHp9 ydbHp9

Gene      
Name: ydbH    Texpresso search in the literature
Synonym(s): ECK1378, G6703, b1381
Genome position(nucleotides): 1443051 --> 1445690 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.12
External database links:  
ASAP:
ABE-0004623
ECHOBASE:
EB2972
ECOLIHUB:
ydbH
OU-MICROARRAY:
b1381
STRING:
511145.b1381
COLOMBOS: ydbH


Product      
Name: PF11739 family protein YdbH
Synonym(s): YdbH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 96.835
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
36 -> 36 I
657 -> 858 RIAEVINLVTAKNITADLQGRYPWTEEEPLLLTDVSVDVLGGNVLMKQLRMPQHDPALLRLNNLSSSELVSAVNPKQFAMSGAFSGALPLWLNNEKWIVKDGWLANSGPMTLRLDKDTADAVVKDNMTAGSAINWLRYMEISRSSTKINLDNLGLLTMQANITGTSRVDGKSGTVNLNYHHEENIFTLWRSLRFGDNLQAWL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6703-MONOMER
ECOLIWIKI:
b1381
INTERPRO:
IPR021730
PFAM:
PF11739
PRIDE:
P52645
REFSEQ:
NP_415899
SMR:
P52645
UNIPROT:
P52645


Operon      
Name: ydbH-ynbE-ydbL         
Operon arrangement:
Transcription unit        Promoter
ydbH-ynbE-ydbL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydbHp9 1442900 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1789 1445572 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB