RegulonDB RegulonDB 10.9: Gene Form
   

feaR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

feaB feaR ydbL FeaR FeaR CRP QseB Nac PhoB QseB NsrR feaBp1 feaBp1 feaRp3 feaRp3 feaBp2 feaBp2 feaRp feaRp feaRp1 feaRp1 feaRp2 feaRp2

Gene      
Name: feaR    Texpresso search in the literature
Synonym(s): ECK1381, G6706, b1384, maoB, maoX, ydbM
Genome position(nucleotides): 1446378 <-- 1447283 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.57
External database links:  
ASAP:
ABE-0004630
ECHOBASE:
EB3198
ECOLIHUB:
feaR
OU-MICROARRAY:
b1384
STRING:
511145.b1384
COLOMBOS: feaR


Product      
Name: DNA-binding transcriptional activator FeaR
Synonym(s): FeaR, MaoB, MaoX, YdbM
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol
Molecular weight: 34.62
Isoelectric point: 6.868
Motif(s):
 
Type Positions Sequence
12 -> 185 WLSQINQVCGNFTGRLLTERYTGVLDTHFAKGLKLSTVTTSGVNLSRTWQEVKGSDDAWFYTVFQLSGQAIMEQDERQVQIGAGDITLLDASRPCSLYWQESSKQISLLLPRTLLEQYFPHQKPICAERLDADLPMVQLSHRLLQESMNNPALSETESEAALQAMVCLLRPVLH
199 -> 299 QKVVTLIDDNIREEILRPEWIAGETGMSVRSLYRMFADKGLVVAQYIRNRRLDFCADAIRHAADDEKLAGIGFHWGFSDQSHFSTVFKQRFGMTPGEYRRK
217 -> 238 EWIAGETGMSVRSLYRMFADKG
266 -> 289 LAGIGFHWGFSDQSHFSTVFKQRF
219 -> 298 IAGETGMSVRSLYRMFADKGLVVAQYIRNRRLDFCADAIRHAADDEKLAGIGFHWGFSDQSHFSTVFKQRFGMTPGEYRR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [GEA] Gene expression analysis
[HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
Reference(s): [1] Hanlon SP., et al., 1997
[2] Yamashita M., et al., 1996
External database links:  
ECOCYC:
G6706-MONOMER
ECOLIWIKI:
b1384
INTERPRO:
IPR020449
INTERPRO:
IPR037923
INTERPRO:
IPR035418
INTERPRO:
IPR018060
INTERPRO:
IPR009057
MODBASE:
Q47129
PFAM:
PF14525
PFAM:
PF12833
PRIDE:
Q47129
PRINTS:
PR00032
PRODB:
PRO_000022590
PROSITE:
PS01124
REFSEQ:
NP_415902
SMART:
SM00342
SMR:
Q47129
UNIPROT:
Q47129


Operon      
Name: feaR         
Operon arrangement:
Transcription unit        Promoter
feaR
feaR
feaR
feaR


Transcriptional Regulation      
Display Regulation             
Activated by: Nac, CRP, QseB
Repressed by: NsrR, PhoB, QseB
Growth Conditions:

[1] 

C: Escherichia coli| LB medium| glucose 0.5%
E: Escherichia coli| LB medium

[2] 

C: Escherichia coli| M9 minimal medium| glucose 0.5%; thiamine 10 g/mL; tyramine 3 mM| oxygen atom| 37.0 C
E: Escherichia coli| M9 minimal medium| succinate 0.5%; thiamine 10 g/mL; tyramine 3 mM| oxygen atom| 37.0 C

[3] 

C: Escherichia coli| multicopy plasmid pDEL15 (maoB) mutant| M9 minimal medium| glucose 0.5%; thiamine 10 g/mL| oxygen atom| 37.0 C
E: Escherichia coli| multicopy plasmid pDEL15 (maoB) mutant| M9 minimal medium| glucose 0.5%; thiamine 10 g/mL; tyramine 3 mM| oxygen atom| 37.0 C

[4] 

C: Escherichia coli| LB medium
E: Escherichia coli| crp knockout mutant| LB medium

[5] 

C: Escherichia coli| LB medium
E: Escherichia coli| cyaA knockout mutant| LB medium

[6] 

C: Escherichia coli| M9 minimal medium| glucose 0.5%; thiamine 10 g/mL| oxygen atom| 37.0 C
E: Escherichia coli| M9 minimal medium| succinate 0.5%; thiamine 10 g/mL| oxygen atom| 37.0 C



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Hanlon SP., Hill TK., Flavell MA., Stringfellow JM., Cooper RA., 1997, 2-phenylethylamine catabolism by Escherichia coli K-12: gene organization and expression., Microbiology 143 ( Pt 2):513-8

 [2] Yamashita M., Azakami H., Yokoro N., Roh JH., Suzuki H., Kumagai H., Murooka Y., 1996, maoB, a gene that encodes a positive regulator of the monoamine oxidase gene (maoA) in Escherichia coli., J Bacteriol 178(10):2941-7


RegulonDB